KEGG   Propionibacterium acnes C1: PAC1_04240Help
Entry
PAC1_04240        CDS       T02330                                 

Definition
magnesium-chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pacc  Propionibacterium acnes C1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pacc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(885596..887398)
Genome map
AA seq 600 aa AA seqDB search
MPRHFPFVAIVGQSEPRLALTLLAIDPMIGGVLITGPLGTAKSTCARSFVDLVPGIVVRD
VTAGTTVDRLIGSMDLEAALASGRRRDHVGLLTEAQALCADDVNLFDDAVTAALIGRPED
LPLIATMAVGADTVHPQLLDRFGLCAVTVPCRNPKDRELIVNHRLTFDDGPDSFITTCTD
ATNEVVNRICAARNKLPDLEWTDAARNKFTELLTQAHAPGQRADLGLARSATAYAAWRGD
NNVVVEDVTAVAELVLRHRRRNLSSSQAPSPDLNDAHSHSGPSSPHDGNEQLDEKGHDDS
TAASPRVIAPEETFNVLTSTPAAYDRTQRRARGRRMVTRSADLRGHVISSQPTRQPVDLS
LPATLRAAAPHQRARRASGEGRDGLSVVVKRSDWRRKVRESRTSTLVVFIVDASGSMGAR
GRMAASKAAVIGLLQDPYVKRDRVAVITFSGNNARVIVPATSSIQRAQRLLTTMAVGGQT
PLASGLSCAGRLIETELRRDSTLRPVAIVVTDGGGNVGLDGRVDRTATNQAFDVAQTLSD
DTRTSWIIVDTSVNRVHQRDCEALSGILHAPRMTIDDLQSGVFIPFIRSTSRALSYSQRD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcattttccctttgtagcgatcgtgggccagtctgaacccagattggccctc
acgctgctagccatcgatccaatgatcggtggggtcctcatcacaggccctctcggcacg
gccaaatcaacctgtgcgaggtccttcgttgacctcgttccagggatcgtcgtccgtgac
gtcacggcaggcactaccgtggaccgattgatcggcagcatggatctcgaggctgcatta
gccagcggacggcgccgtgatcatgtcggcctcctcaccgaagcccaggctctgtgcgcc
gacgatgttaacctctttgatgacgccgtaacagctgccctcattggtcggcccgaagac
ctacccctcatagcaacaatggccgtaggggcggacaccgtccatccccagctcctcgac
cgctttggtctgtgcgccgtgactgttccctgtcgtaacccaaaggaccgggagctcatt
gtcaatcatcgccttacgttcgacgatggcccagactccttcattactacatgcacagat
gccaccaatgaggtcgtgaaccgtatttgtgctgctcgaaacaaacttcctgacctggaa
tggaccgacgctgcacgaaacaagttcacagagctcttgacacaagcgcatgctcccgga
cagcgcgccgatcttggtttggctcgatcggcgactgcttacgcggcgtggcggggggac
aataatgtcgtcgtcgaagacgtcactgcggtggccgagctcgtcctgagacaccgccgg
cgaaacttgtcttcgtctcaggccccctcaccggatctcaatgatgctcactcccacagt
ggcccctcatcgccgcacgacggaaacgagcaactggatgaaaaaggccacgacgacagc
acggcagcttccccgagggtcatcgcccctgaggaaacctttaacgtactcacatccacc
cccgcagcatatgaccgaactcaacgtcgggcccggggacgccgaatggtcacccgatca
gcagatcttcggggccatgtgatcagctcacaaccgactaggcaaccggtcgatctgtca
ctgccggctaccctacgagcagctgcccctcaccaaagagcgcggcgtgcatcaggagag
ggacgtgatgggttgtccgtagtcgtcaaacgctctgactggagacgcaaggtgcgcgag
agtcggacgtcgactctcgtcgtattcatcgtcgacgcaagtggatccatgggtgcccgg
ggccgaatggcagccagcaaggcagcagtcatcggcctgctccaagatccctacgtaaaa
cgtgatcgtgtcgccgtgatcacgttctctggcaataacgctcgagtgatcgtgcctgcg
acatcgagtatccagcgtgcacagcggcttctgacgacgatggcagtcggcggacagacg
ccgctggcatcagggctctcatgcgctggaagactcatcgagacagagttgcgacgggat
tctacccttcgccccgtcgccatcgtggtgaccgatggtggcggtaacgttggacttgac
ggtcgggtggaccgaactgccaccaatcaggcattcgatgtcgcacaaactttgtccgac
gacacaagaacctcgtggatcatcgtagatacctccgtcaaccgagtccatcaaagggac
tgcgaagcactgtcaggaattcttcatgcgcctcgcatgaccatcgacgatctgcaatcc
ggagtcttcatccctttcattcgatccacgagtcgagccctttcttattctcagagagat
tga

DBGET integrated database retrieval system