KEGG   Propionibacterium acnes C1: PAC1_04455Help
Entry
PAC1_04455        CDS       T02330                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pacc  Propionibacterium acnes C1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pacc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pacc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932516..933691
Genome map
AA seq 391 aa AA seqDB search
MTDQRGAICGAATLVVKVGSSSLTLPGGGIDVRRVDDLVDALSEVIAVGRRVVLVSSGAI
ATGFPAMGITHRPRTLAGKQAAASVGQGILLAHYASRFASHGLRVGQVLLTVNDLVRPTS
YRNAWSTLDTLLGLGVVPIVNENDTVATGEIRFGDNDRLAALVAELVRAQALILLSDVDA
LYTAHPDSPDARRVEVVEDIDTLDVDTHKAGSGVGTGGMTTKLEAARMATCAGVPVVLAA
AVDAPDVLAGAPVGTYFRPLATRRPRRLLWLADAATPQGQIVIDDGAVEALTQRHSSLLA
VGVTRVHGDFQAGDPVTILASDGRVVGRGIAQFSHDEVRVMRGRSSAWLAAEMGPAASRE
IIHRDAMVLSRRRNAEPSSRNQKSSGSRVTS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatcagcgtggagccatatgcggggccgccaccctggtggtcaaggtcggatct
tcctctttgactcttcctggtggcgggattgacgttcgtcgtgttgacgacctggttgat
gcgctgagtgaggtcatcgcggtcggccggcgtgtcgtcctggtgagttccggggcgatt
gccaccggatttcccgccatggggataactcatcgtccgcgcactttggctggcaagcaa
gcggccgcgtcggtgggacaaggtattttactggctcactacgcgtcgaggtttgccagt
cacgggttgcgggtggggcaggtactactcaccgtcaatgacctggtgcggcccacctcg
taccgcaatgcctggtcaaccctcgacactttgctggggttgggcgtcgtgccgatcgtc
aacgagaacgacacggtcgccaccggagaaattcggtttggcgataatgatcggcttgct
gccctggtagccgagctggtgcgcgctcaagccctcatcctgctctctgacgttgacgcc
ttgtacaccgcccatccggattcaccggatgctcgtcgcgtggaggttgtggaggacatc
gacacattggatgtcgatacccataaagctggttcgggggtgggaaccggcggcatgacc
acgaaacttgaagccgcccgaatggccacctgtgccggggtaccggtggtactcgcagcg
gcggtggatgccccggacgttctggctggtgcccccgtgggtacctacttccgcccgctg
gcgacgcgacggccccgacggttgctgtggttggccgacgctgccaccccgcagggacag
atcgtcatcgacgacggagctgtcgaagctttgacacagcgtcattcctcgttgttggcg
gtgggtgtgactcgggtacacggggatttccaagcaggcgacccagtgacgatcctggcc
tccgacggtcgagttgttggtcgcggtatcgcccagttctcccatgatgaggtgcgcgtc
atgaggggacgttcgagtgcctggctggccgcagaaatgggcccggcggcctctcgcgag
atcatccaccgcgatgccatggtgctgagtcgtcgtcgtaacgctgagccgtcgtcgagg
aaccagaaaagtagcgggtcaagggtgacgtcctga

DBGET integrated database retrieval system