KEGG   Propionibacterium acnes C1: PAC1_05915Help
Entry
PAC1_05915        CDS       T02330                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pacc  Propionibacterium acnes C1
Pathway
pacc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pacc01100  Metabolic pathways
pacc01110  Biosynthesis of secondary metabolites
pacc01130  Biosynthesis of antibiotics
pacc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAC1_05915
Enzymes [BR:pacc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PAC1_05915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-ProteinID: AFU40938
Position
1231392..1232192
Genome map
AA seq 266 aa AA seqDB search
MPPTVTGTVLDGIISGVLEDLHERQLMVTSDNLREATELVAPAIDPIPRLTAPGLSVISE
IKRSSPSNGQLAAIHDPAALADQYRSGGAAAISVLTEERRFQGSLADLDAVRAKVEIPVL
RKDFVVAEYQVLEARAHGADLILLIVAALSDDDLQRLYDLAIELGMTPLVEVHTPEEVSR
ATALGARVVGVNARNLKTLEVDKTIFRELLGELPENVVKVAESGILCVDEAVEVYDLGAD
AVLVGEMLVRHGEPAQVLRKIHRATV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccactgttaccggaacggtccttgacggaatcatttccggtgttctcgaagat
cttcatgagcgccaactcatggttacctcggacaatcttcgtgaggccactgagctcgtg
gcccctgctatcgatccgatcccgaggctgacagcgcctggcctgtcggttatctcagaa
atcaagcggtcgagcccgtcaaacggccagctggctgctattcatgaccctgccgcactg
gctgatcagtaccgctccggtggagccgctgctatcagcgttctgactgaggagcgccga
tttcaaggatccctggccgaccttgacgcggtgcgtgcgaaagttgagatcccagtactc
cgcaaggatttcgttgtcgcggaataccaggtgctcgaagcccgtgcacacggggcagac
cttatcctcctcatcgttgccgcgttatctgacgacgacttgcaacgcctatatgacctt
gccatcgagctgggcatgaccccgctagttgaagttcatacccctgaagaggtaagtcga
gctacagcccttggtgcccgtgtggtgggtgtgaatgcgcgcaacctcaagaccctcgaa
gtcgataagaccattttcagggaactccttggtgagctgcctgaaaacgtcgttaaggtg
gcggaatccggaattctttgcgtggacgaggccgtcgaggtatatgaccttggtgctgac
gcggtgttggtgggggagatgctggtccgccacggtgaaccagcacaagtattgcgcaag
atccaccgtgccaccgtgtga

DBGET integrated database retrieval system