KEGG   Propionibacterium acnes C1: PAC1_05915Help
Entry
PAC1_05915        CDS       T02330                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pacc  Propionibacterium acnes C1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pacc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pacc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1231392..1232192
Genome map
AA seq 266 aa AA seqDB search
MPPTVTGTVLDGIISGVLEDLHERQLMVTSDNLREATELVAPAIDPIPRLTAPGLSVISE
IKRSSPSNGQLAAIHDPAALADQYRSGGAAAISVLTEERRFQGSLADLDAVRAKVEIPVL
RKDFVVAEYQVLEARAHGADLILLIVAALSDDDLQRLYDLAIELGMTPLVEVHTPEEVSR
ATALGARVVGVNARNLKTLEVDKTIFRELLGELPENVVKVAESGILCVDEAVEVYDLGAD
AVLVGEMLVRHGEPAQVLRKIHRATV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccactgttaccggaacggtccttgacggaatcatttccggtgttctcgaagat
cttcatgagcgccaactcatggttacctcggacaatcttcgtgaggccactgagctcgtg
gcccctgctatcgatccgatcccgaggctgacagcgcctggcctgtcggttatctcagaa
atcaagcggtcgagcccgtcaaacggccagctggctgctattcatgaccctgccgcactg
gctgatcagtaccgctccggtggagccgctgctatcagcgttctgactgaggagcgccga
tttcaaggatccctggccgaccttgacgcggtgcgtgcgaaagttgagatcccagtactc
cgcaaggatttcgttgtcgcggaataccaggtgctcgaagcccgtgcacacggggcagac
cttatcctcctcatcgttgccgcgttatctgacgacgacttgcaacgcctatatgacctt
gccatcgagctgggcatgaccccgctagttgaagttcatacccctgaagaggtaagtcga
gctacagcccttggtgcccgtgtggtgggtgtgaatgcgcgcaacctcaagaccctcgaa
gtcgataagaccattttcagggaactccttggtgagctgcctgaaaacgtcgttaaggtg
gcggaatccggaattctttgcgtggacgaggccgtcgaggtatatgaccttggtgctgac
gcggtgttggtgggggagatgctggtccgccacggtgaaccagcacaagtattgcgcaag
atccaccgtgccaccgtgtga

DBGET integrated database retrieval system