KEGG   Propionibacterium acnes C1: PAC1_05995Help
Entry
PAC1_05995        CDS       T02330                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pacc  Propionibacterium acnes C1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAC1_05995
Enzymes [BR:pacc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PAC1_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1250060..1251490
Genome map
AA seq 476 aa AA seqDB search
MKRILWGGATAASQYEGGFYDGKGMDTQDCRRWIPRLSNDTIQTRLLTEADIRNAKNSRS
DDCRFPFRMGSRGYEYWESDLHYITSLGLDVYRLSISWARLFPTGFEDQPNPEGVMYYDR
IIRTLAHAGIKVFITINHYAMPIAIVDKYGGWRHRDVIDLYLKMAKFVVDRWQENVDYWL
PVNEINSGYFSPYNGLGIIGTIDYSYDYRSVFNGLHYQMIASALITKYGRDIGARGKFVC
MVSCFDYYALHPTPEDNMKLVHDEQINQWWCADVLATGEYGYYTEKFLADHGVVLDITDK
DRGILRSNTCDIVSFSYYSSSICSVDEKREQVPGNLVPTLRNPSLEATEWGWQIDPMGLR
ITAHKVYDRYRKPIMVAENGLGARDNVDSDGRIHDNYRISYLERHMEQAELAVREGVDIE
AYFVWGIIDIVSAGSCEMEKRYGVVYVDADNEGRGTYKRLPKDSFYWYRDFIASHR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattctgtggggtggggctaccgcggccagtcaatatgaaggcgggttctac
gacggaaagggaatggacacccaagactgtcgtcgatggattccgcggctatcgaatgat
acgatacaaactcgtctcctcaccgaggctgatattcgaaacgcaaagaattctcgttct
gacgactgccggttcccgttccgtatgggatcgcggggttacgaatactgggaatcagac
ttacactacattaccagtcttggcctagatgtatatcgtctttcgattagctgggcccgt
ctatttcccactggtttcgaggaccagcccaatccggaaggggtgatgtactatgaccgg
attattcgcacccttgcacatgctggaattaaagtcttcatcacgatcaatcactatgcg
atgccgattgcgatcgttgacaagtacggaggttggcgacatcgtgacgtcatcgatctg
tatcttaagatggcgaaatttgtcgtcgatcgctggcaagaaaatgtagactattggctt
cctgtaaacgagattaactccgggtatttcagtccttataatggactcggaataatagga
accatcgattactcctatgattatcggtcagtctttaatggtcttcattaccaaatgata
gcaagcgccctcataacaaaatacggtcgcgatatcggagcacgaggaaagttcgtgtgc
atggtgagctgtttcgattactatgcgctccatcccacacctgaggacaacatgaagctc
gttcacgacgagcagatcaatcagtggtggtgtgcagatgtactagcaacaggtgaatac
gggtattacacagagaagttcttggccgaccatggggtagtactcgacatcacggacaag
gaccgtggcatactcaggtcgaatacctgtgacatcgtgtcattttcgtactattcatcg
tcgatttgtagtgtagacgaaaaacgtgaacaagtccctggaaacctggtaccaacattg
agaaaccctagtttggaagctaccgagtggggatggcagatagaccccatgggtttgagg
attacggctcacaaggtttacgaccggtaccggaagcccataatggttgctgagaatgga
ttgggtgcgcgggataatgtcgactctgatgggcgtatccacgataattatagaatatca
tatctcgagcgccatatggaacaggctgagcttgccgtgcgggagggtgtagatatagaa
gcatatttcgtttggggcatcattgacatcgtcagtgccggtagttgcgaaatggagaaa
aggtacggtgtcgtctatgtcgacgcagacaacgaagggcggggaacttataaacggttg
ccgaaagatagtttctattggtatcgcgacttcatcgcctctcataggtga

DBGET integrated database retrieval system