KEGG   Propionibacterium acnes C1: PAC1_06060Help
Entry
PAC1_06060        CDS       T02330                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pacc  Propionibacterium acnes C1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pacc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1264575..1265180
Genome map
AA seq 201 aa AA seqDB search
MISHFSGMVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALTPRGASVSGATHVVAPWREQVAEGLVGLGWSAKDAEKAVDKVAALK
EADPAMTIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcatggttagtgccgctggcccgacgtgggtcgtccttgac
aatcatggggttggtatcaaggtgctgtgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacctccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
ataaccgaagaagatgacgcaactctatgccgcgttcccggaattggtcgcaagggtgcg
gcgaaaatgattctggagctcaaggacaaggtcgcagcccttaccccacgtggagcttcg
gtgagcggagcgacccatgtggtcgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcggctaaagacgcggagaaggccgtcgacaaggtggctgctctcaag
gaagccgatccagctatgaccatcggcaacctcatgcgagcggcattgcgtagtttggcg
cggtga

DBGET integrated database retrieval system