KEGG   Propionibacterium acnes C1: PAC1_06060Help
Entry
PAC1_06060        CDS       T02330                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pacc  Propionibacterium acnes C1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAC1_06060 (ruvA)
Enzymes [BR:pacc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PAC1_06060 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1264575..1265180
Genome map
AA seq 201 aa AA seqDB search
MISHFSGMVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALTPRGASVSGATHVVAPWREQVAEGLVGLGWSAKDAEKAVDKVAALK
EADPAMTIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcatggttagtgccgctggcccgacgtgggtcgtccttgac
aatcatggggttggtatcaaggtgctgtgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacctccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
ataaccgaagaagatgacgcaactctatgccgcgttcccggaattggtcgcaagggtgcg
gcgaaaatgattctggagctcaaggacaaggtcgcagcccttaccccacgtggagcttcg
gtgagcggagcgacccatgtggtcgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcggctaaagacgcggagaaggccgtcgacaaggtggctgctctcaag
gaagccgatccagctatgaccatcggcaacctcatgcgagcggcattgcgtagtttggcg
cggtga

DBGET integrated database retrieval system