KEGG   Propionibacterium acnes C1: PAC1_06325Help
Entry
PAC1_06325        CDS       T02330                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pacc  Propionibacterium acnes C1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAC1_06325
Enzymes [BR:pacc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PAC1_06325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1324620..1325534)
Genome map
AA seq 304 aa AA seqDB search
MDIAVVGSNMVDLISYIHRMPSDGETVEAPEFRMGCGGKGANQAVAASRLGAEVVMVTRV
GNDVFADTTLDNFRKNGIDTTHVLRTDASSGVAPIFVDPESRNSILIIKGANAQLSPADV
EGARQDIATCKLIMLQLEIPLETVYATIELGDVLGIPILLNPAPVAPELDLERIRGIEFF
MPNESELELITGMPVDTLDDIGKATDVLLGAGITNIIVTLGSRGAMWAHAEGRKIIKAPV
VQAVDTTGAGDAFIGCFAKEWVDHGDVIAAIRAGNRYAADSVTRHGTQSSYALADGSLPE
WLRS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccgttgttgggtccaatatggtggacctcatctcctacattcatcgcatg
ccatcagacggtgaaaccgtcgaggctcccgaattccgaatgggatgcggcggcaaaggt
gcgaatcaggcagtagctgcgtcacgtctcggtgcagaggtcgtgatggtcacccgagtg
ggcaacgatgtgttcgccgacaccacgttggacaactttcgcaaaaacggtatcgatact
acccatgtgttgcgtaccgatgcgagctccggggtggcaccgatcttcgtcgatccagaa
tcgcgtaactccatcctcatcatcaagggagctaacgctcagctgagtcctgctgatgtc
gagggtgcccgacaagacattgccacgtgcaaactcatcatgctgcagctggagattccg
ttggagacggtctacgccacgattgagttaggggacgtactggggatcccaatactcctc
aatccggctccggtcgcaccagaactggatcttgagcgaatccgcggaattgagttcttc
atgccgaacgagtccgagcttgaactcataacggggatgccagtagacaccctcgatgat
atcggcaaggctactgatgtgctgctgggagcgggcatcacgaatatcatcgtaactttg
ggctcgcgtggtgcgatgtgggcccacgcagaaggacgcaaaatcatcaaggccccggtt
gttcaagccgtggacacgacaggtgctggcgatgccttcataggctgctttgctaaagaa
tgggtagatcacggcgacgtgatagctgcgattcgtgcaggaaacaggtatgcggctgac
tcggtcacacgccacggaactcagagctcgtatgccttggccgatggaagtctcccggag
tggctgagatcatag

DBGET integrated database retrieval system