KEGG   Propionibacterium acnes C1: PAC1_06900Help
Entry
PAC1_06900        CDS       T02330                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pacc  Propionibacterium acnes C1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pacc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434843..1436729
Genome map
AA seq 628 aa AA seqDB search
MTDLVPVAAGSRLEPFARAGVLEASDIHLANLVCRIGGETNCDVSLAIALSCRELRRGSV
FWDPHEIANVVRQQILDPAIPDIETSDQAALFAELEWPPPGEWLSTLEASPVIAGRDDPL
NRLPARLDDGLVYLEKYWQAEHDVARDLATLAADPPSQGPVSADDVVSSISNALAASGIM
LDPAQADAAIAAIMHRVSVLAGGPGTGKTTTVCALLAALQQADPHLGAVAVAAPSGKAAA
RLRDSVSQVSERMPDDLKPIVADATTVHSLLKWQGPGTSFGYDEQHKLPFGVVVVDEASM
LSLPLAASLLSAIGPQTRLILVGDPGQLVSVDAGSVLADIVSSADALQAQLPVTILTCNH
RSRGDIARLSEAVREGDKSTALDVLATAAGVTHDSPSPDSIATISGRRSITWIDADPASI
TMADLPAVAEVIARTGARMLELAQASADAAALKLVDAHRLLCAHREGPYGVDEWSQRMVT
VLSDVLPGVGQGRWVLGETAIVTHNLAQLGVNNGDCGVIVETRPVPTIALPGPGGVPRRL
PCSLIPSLQPLQAMTIHKAQGSQFTDVTVVLPPPDSPLLSRELLYTAITRAREHLTVVGT
RESVERAIDRANDRRSGIQRRWEESRTS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctcgtcccggtagcagcaggaagtcggctcgagcccttcgcccgagccgga
gtcctcgaggccagcgacatccatttagccaatctagtgtgccgcatcggtggcgagacc
aactgcgatgtcagcctcgccatcgctttatcatgccgtgagcttcggcgcgggtccgtg
ttctgggacccacatgaaatcgcaaacgtcgtccgccagcaaatccttgatccggcaatt
ccagacatcgaaaccagcgaccaggcagccctattcgcggaattggaatggccacctcca
ggcgagtggctgtccacgctagaggccagtcccgtcattgctggccgtgatgatccgctc
aaccggttgccggctcggcttgatgatggcctggtctacctagagaaatattggcaagct
gagcatgatgtcgcccgcgatctcgctaccctcgctgcggatccgccaagccaaggccca
gtgtcggccgacgatgttgtttccagcatcagtaatgccttagcagcatccggaattatg
ttggatccagctcaagctgatgctgccatcgccgcaattatgcaccgagttagtgtgctt
gcaggtggccccggaaccggcaagacaactacggtatgcgccctcctagctgccttgcaa
caggctgaccctcatcttggagccgtggccgttgcggctcccagcggcaaagcagcggca
cgcttgcgtgactcagtttcgcaagtttcagagcgaatgcccgatgacctgaaaccgatt
gttgctgacgcaactaccgtccactcactgctgaaatggcaggggccgggaacctcattc
ggatatgacgagcaacacaagcttccgttcggagtcgtcgtcgttgacgaagcatcaatg
ctttctctgcctctggccgctagcctcctctctgcaatcgggcctcaaactcgtctaatt
ctcgtcggggacccagggcagcttgtctcggtggacgccggtagtgtcctggccgacatc
gtttcgtcggctgatgccctccaagcgcagcttcctgtcacgatcctcacctgtaaccac
cgctcgagaggagatatcgcacggctgtcggaggcggtacgcgagggagacaagagcact
gcgttggacgtattggcgacagctgctggcgtgacacatgactctccttcccccgatagc
atcgcgacgatcagtggtcgtcgcagtattacgtggatcgacgctgacccggcgagtatc
accatggccgaccttccggcggtcgcggaggtgatcgcacgcaccggggcaagaatgctt
gagcttgctcaggctagtgccgacgctgctgctctcaaactcgtcgatgcccaccggttg
ttgtgcgctcaccgagaggggccatacggggtagacgagtggtctcagcgcatggttact
gtactttcagatgtgttgcctggtgttggccaaggccggtgggttctcggcgaaactgca
atagtaacgcataacctcgcacaattgggagtcaataacggcgattgcggggtcatcgtt
gaaacaaggcccgtccccacgatagctctaccgggacccggtggagtccccagacggttg
ccctgttccctcatcccatcgctgcaacccttacaggcgatgacgattcacaaagcgcag
ggcagccaattcacggacgtaacggtggtcctgccaccacccgactcgcccctcctctct
cgtgagttgctctataccgccatcacgcgtgcacgtgaacacctcactgtggtgggcaca
agggagtctgtggagagggcgattgaccgggctaatgatcgacgttctgggattcagcgc
cggtgggaagaaagtcgcacttcctga

DBGET integrated database retrieval system