KEGG   Propionibacterium acnes C1: PAC1_07610Help
Entry
PAC1_07610        CDS       T02330                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pacc  Propionibacterium acnes C1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PAC1_07610
Enzymes [BR:pacc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PAC1_07610
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PAC1_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1573966..1574736)
Genome map
AA seq 256 aa AA seqDB search
MLELPEVETVRAGLEQFVVPVVVDSVDVVDTRGLRPSGGLEDAALFETTLSGRQFTAVNR
RGKYLWFILDDGTAMLAHLGMSGQFRVSTQHAPQHRHTRIVITLDDGRDLRFLDQRTFGG
LTLAPLVDGIPGPVTHIAPDPFEECFDVDEVVRRLCARRSAIKRSLLDQTLVSGIGNIYA
DETLWRVRCHPETPCSRLSQSEAVELLQTACDVMAEAMSQGGTSFDSLYVNVNGESGWFS
RVLDAYGREDELLPPM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgagctccccgaggtcgagaccgttcgagccggactcgaacagttcgttgttccg
gttgtcgtcgacagcgtcgacgttgtcgatactcgcgggcttcgccccagcggtggactc
gaggacgctgcgcttttcgagacgaccttgtcgggtcgtcaatttactgccgtaaatcgc
cggggtaagtacctgtggttcatccttgacgatggcaccgcgatgttggctcatctaggt
atgagcggacaattccgtgttagcacccaacatgccccgcagcatcgccatacccgtata
gtcatcaccctcgacgatggtcgtgacctgcgcttcctcgaccagcgcaccttcggcgga
ttgaccctagccccgctcgttgatggtattcccggtccggtgacccacatcgcccctgat
ccgttcgaggagtgtttcgacgttgacgaggtagtgcgacggttgtgcgcacgcaggtcc
gccattaagaggagtttgctcgatcaaacccttgtttccgggattggcaatatctatgcc
gacgaaactctttggcgggtccgttgtcaccccgagacaccatgctctcgcctgagtcaa
tccgaagcggtggaattgttgcagacggcctgcgatgttatggcagaggccatgtctcag
ggcggtacctctttcgactctctttatgtcaacgtcaacggggaatcggggtggttttcc
cgtgttttggatgcctacggccgtgaggatgagctcctgccaccgatgtga

DBGET integrated database retrieval system