KEGG   Propionibacterium acnes C1: PAC1_08480Help
Entry
PAC1_08480        CDS       T02330                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pacc  Propionibacterium acnes C1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAC1_08480
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PAC1_08480
Enzymes [BR:pacc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAC1_08480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1766360..1767394
Genome map
AA seq 344 aa AA seqDB search
MNPRAVEIAKKLSPEQRAGQCILVGVVPSDSPEYITNLIDTQCLAGIFLLGHWTSRSKLE
AMLSAVNHVSPQGIKPIVATDHEGGEIQNIRVPGVDHLPSQEALARMSPAKVQAVVTTGA
RQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRKAGI
ISTTKHFPGIGRITEDTDFKSAGITDDKTTRHDRYVESFRMAFDAGSEAVMIASAYYSKI
DPGTLGLFSSKMMTDMLRGDFGYQGLIVSDDLGSSVSVFSVDGGHRASKFVSAGGDLAIT
ADPLLAGPMIRALTSTATSASGKKRLVDAASHVINVKLAHSLTK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcgagctgtcgaaatcgccaagaaattgtctcccgagcaacgcgccggccaa
tgcattcttgtcggcgtagtgccatcagactcccccgaatacatcaccaacctcattgac
acccagtgcttagccggaatcttcctgctaggacactggacgagcaggtccaagcttgag
gccatgctcagcgctgttaatcacgtcagcccgcagggcatcaaacctattgtcgcaact
gaccacgaaggtggcgaaatccagaacatccgggtgccaggagtcgatcacctgccgagt
caggaagctctggcccggatgtccccggccaaggtgcaagcagtcgtaacgaccggtgct
cgtcaactcgccaaactcggcgtccatatggtcttctcccccgtggctggcgtcatcgac
cctcgccttggggtacgtaataagccaattgccaagcatcatcgtggtttcggaaccgat
ccgcacctctgcgggcaatactcggcagccgtcgttgcgggacaccgcaaagcggggatc
atttcgaccactaagcattttcctggcatcggacggatcacggaggatactgacttcaaa
tccgccgggattactgacgacaagaccacccgccacgaccgatatgttgagtctttccgg
atggcctttgacgctggatctgaagccgtcatgatcgcatccgcgtactactcaaagatc
gatcccggcaccctcgggttattttcatcaaagatgatgacagatatgctgcgcggagac
ttcggttatcagggactcatcgtgtccgacgacctggggagttcagtctcagtattctca
gtcgatggtggtcatcgggcaagcaaattcgtctctgccggcggcgatctagctatcaca
gctgacccccttctggcaggccccatgattcgcgcgttgacgtcgaccgcgacgtccgcg
tccggtaagaagcgtcttgttgacgctgctagccatgtcatcaatgtcaaattggcgcat
tcattgacgaagtga

DBGET integrated database retrieval system