KEGG   Propionibacterium acnes C1: PAC1_08660Help
Entry
PAC1_08660        CDS       T02330                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pacc  Propionibacterium acnes C1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pacc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1808533..1810641)
Genome map
AA seq 702 aa AA seqDB search
MSLTDPHLTTLADHFGIARDYYDWKGQHTEVGEATVIAVLDGLGIDASTPERAERACHEV
TNRKWRRVLPGIVVLREGQEGRVDVHVNAGEWVEVHVVCEDGQRRECWQVDNWNPDRHVD
DRWIGEATFGIPGDLPLGYHTIVATTADHRATSTLVVSPNWLGLPRSMGSSRVWGHAVQL
YSTRSRASWGMGDFSDLADLSTWAATQGADYVLVNPLHASQVVSPIEPSPYLPCSRLFLN
PLYVRPEIIPEYADLDVYVRSQARSARAQAAADAEAIDRDRSWNAKLPVLEAVHALGLEG
SRELSYQAFRRLCGTRLEDLATWCALTEVYGNDWRTWPEEYQRPSNRAVSEFVRAHEERV
DFFMWLQWIADQQLSAAQSAGRDAGMSLGLMCDMAVGVSGAGADAWMLGKLFADGVCVGS
PPDAFNQAGQEWGQPPMRPDILANLAYRPFRDMVRAALRHAGGIRIDHILGLFRLWWVPV
GLGPRMGTYIRYDHEAMVGILALEAHRAGALVVGEDLGTVEPWVRAYLRERGIMGTSVLW
FENGENGNPLPPEQWREYAMSSVTTHDLPPTTGYLAGDHVEVRHELGLLTESLEHERAEV
ARQTATWIAILRERGVLVGDDPSEEDIVLAMHRMLTRTPSKVLNATLTDAVGDRRTQNLP
GTTNEYPNWRVPLSHPDGSPMWLDEVFTDERAARLSHVMNEK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacagatccccacctgacgaccctggccgatcatttcggcatcgctcgtgat
tattacgactggaagggccagcacaccgaggtcggggaggcgactgttattgctgtcctt
gacggtttgggaattgacgcgtcgactccggaacgtgccgaacgcgcgtgccacgaggtg
actaaccggaagtggcgtcgagtgttgcccggaatcgtggtcctacgtgagggtcaagag
gggcgggttgacgttcacgttaatgcaggggagtgggtggaggttcacgtcgtctgcgag
gacgggcaacgccgcgagtgttggcaggtcgacaattggaaccccgatcgccacgtggac
gatcgttggattggtgaggcgaccttcggtatccctggcgatctgccgttgggctaccac
acgatcgtcgcgacgactgcggaccatcgcgcgacctctacgcttgtagtctccccgaac
tggctcggccttcctcgttcgatgggttcgtctcgggtctggggccatgccgtgcagttg
tattcgactcgctcccgcgcctcctggggaatgggtgatttttccgacctggcggacctg
tctacctgggcggccacccagggtgctgactacgtgctcgtgaatccgctgcatgccagc
caggttgtctcccccatcgagccgtcgccgtatttgccttgcagccgtctcttcctgaac
ccgctgtatgtgcgccccgagatcatcccggagtatgccgacctcgacgtctatgtgcgt
tcccaggcacgctcggcccgggctcaagcagcggccgatgctgaggcaatcgatcgagat
cgttcctggaacgccaaactgccagtgctagaagccgtccatgccctcggtctggaggga
tcgagggaattgtcctaccaggcattccgccggctgtgtggtactcgtttagaagatctc
gcgacgtggtgtgcactgacggaggtatacggcaacgattggcgcacctggcccgaggag
tatcagcgccccagcaaccgtgccgtctcagagttcgtgcgagctcacgaggaacgcgtc
gattttttcatgtggctgcagtggattgctgaccaacagctttcggcggcccaatctgcc
ggacgtgacgccgggatgtcgctgggacttatgtgcgatatggccgtgggtgtttccggt
gccggagccgatgcgtggatgctcgggaagctctttgctgacggtgtctgcgtcgggtcg
ccgcctgatgcttttaatcaggctggacaggagtggggacagcctccgatgcgtcccgac
atcctcgccaatctggcatatcggcctttccgcgacatggtgcgcgccgctttgcgtcac
gccggtggcatccgcatcgaccatattctcggcctgttccggctgtggtgggtacccgtc
ggtctcggcccgcgtatgggtacttacatacggtacgaccacgaagccatggttggtatt
ttggcgctggaggcgcaccgggctggcgcccttgtcgtgggcgaggacctgggaacggta
gagccgtgggtgcgcgcctacttgcgtgagcgcggcatcatgggcacctcggtcctgtgg
ttcgagaatggtgagaatggcaatccgctgcctcctgagcagtggcgcgagtacgccatg
agttcggtcactacccatgatttacctcccactactgggtatctggctggtgatcacgtc
gaggtgcgtcatgagctgggactactcactgaatctctcgagcacgagcgcgctgaggtg
gctcgtcagactgccacctggatcgccatcctgcgtgagcgtggcgtgttggtgggggat
gacccctccgaagaggacatcgtgttagcgatgcatcgcatgcttacccgcaccccgtca
aaggtgctcaatgccaccctgactgacgcggtgggagatcgtcgcactcaaaacttgccg
ggtaccacgaatgaatacccaaactggcgggtccctctcagccatccggatggttccccg
atgtggctggatgaggtatttactgacgagcgggctgcgcgactgtctcacgtcatgaac
gagaagtga

DBGET integrated database retrieval system