KEGG   Propionibacterium acnes C1: PAC1_09700Help
Entry
PAC1_09700        CDS       T02330                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pacc  Propionibacterium acnes C1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PAC1_09700
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAC1_09700
   00650 Butanoate metabolism
    PAC1_09700
  Lipid metabolism
   00071 Fatty acid degradation
    PAC1_09700
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAC1_09700
   00310 Lysine degradation
    PAC1_09700
   00360 Phenylalanine metabolism
    PAC1_09700
   00380 Tryptophan metabolism
    PAC1_09700
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAC1_09700
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAC1_09700
   00281 Geraniol degradation
    PAC1_09700
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAC1_09700
   00627 Aminobenzoate degradation
    PAC1_09700
   00930 Caprolactam degradation
    PAC1_09700
Enzymes [BR:pacc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAC1_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2028311..2029246)
Genome map
AA seq 311 aa AA seqDB search
MDEVKISGTDDVTIILDRPRAINSLSGEMLGAIGEAVKGSPRSIDLSGAGERGYCSGADI
RELRSLVLKDPEAAGDWLDGEYDVDAAIAEVHSGTAHLHGISMGGGLGLALRLKRVEARD
DLVLAMPETGIGLWPDVGACFELSRAPRLVGRHIAMTGAFIDAASALWAGLVDEVVDADG
EPVDVDPVACQLARDAVWIQECYDTDDPVEVCRRLADRPEPAARKTAEHIATRCPLSVAV
ALAAVVRAESASGLGEVLETDRALGRSFMRNSDFCEGVRAQLVDKDRNPHWSHESVADVP
ARQVEGMFDPS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtgaagatcagcggtaccgacgatgtcacgatcatcttggaccgtccccga
gcgatcaactcgttatctggtgagatgctgggggctattggggaggccgtcaagggatcg
ccgcgcagcatcgatctatccggtgcgggagagcgcggctactgttcgggagctgacatt
cgcgagctcagatcgttggtattaaaggatcccgaggccgctggtgactggttggatggt
gagtacgacgttgacgctgccattgctgaggtgcattcggggaccgcgcatctgcatggc
atttccatgggcggcgggcttgggttggcgctgcgccttaagcgggtcgaggctcgcgac
gacctcgtccttgcgatgccggaaacgggtattggtctatggcctgacgtgggtgcgtgt
ttcgagctctctcgggccccgcgccttgtcggccgccatatagccatgaccggggccttc
atcgatgcggcttcggcgctgtgggccggtttggtagatgaggtcgtcgacgccgacggc
gagcccgttgacgtcgatccggtcgcttgtcagttggcgcgcgatgcggtgtggattcag
gagtgttatgacactgatgatcccgtcgaggtgtgtcgtcgattggctgatcgtcccgag
ccggccgcgcgtaagacggctgagcacatcgcgacgcgctgtccgttgtcggtagctgtc
gcattggccgctgtcgtgagggctgaatccgcgtcaggtcttggcgaggtgttggagact
gatcgtgctctggggcggtcctttatgcgcaattcggacttttgtgagggggtgcgcgcc
cagctggtcgacaaggaccgcaacccgcattggtcccacgagagcgtggctgacgtgccc
gctcgtcaggttgaggggatgttcgacccgtcctga

DBGET integrated database retrieval system