KEGG   Propionibacterium acnes C1: PAC1_10465Help
Entry
PAC1_10465        CDS       T02330                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pacc  Propionibacterium acnes C1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAC1_10465
Enzymes [BR:pacc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PAC1_10465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2202559..2203281
Genome map
AA seq 240 aa AA seqDB search
MLAWQADDKPVIWFDAEHADESEAVIRGGIPLCAPWFGHGPNNDQDPQHGLARRTDFEVT
VADPFRVVGVAETASIGIRHEVVMTNTALEMTLTLTNHDQKPRVVEGMWHTYLRVADAAQ
ARVRGVRGASWHNFATGDKGSFDANELAVAPDTDTVIQGVGPALALLDSAWGRQIHVETT
GCPSAVVWNPRSSSTHADNPTAQAWRDFVCVETGACKDNAVIVAPHSDLTMSTRISVETL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcctggcaagccgacgacaagcccgtcatctggttcgacgccgagcatgctgac
gagtccgaggccgtgatccggggaggaatcccgctgtgtgccccgtggtttggtcacggc
cccaacaatgatcaggacccccagcatggtctagcccgtcgcaccgacttcgaagtaacg
gtcgctgatcccttccgcgttgtcggggttgctgagaccgcgtccatcggaatccgtcac
gaggttgtcatgacgaacacagccttagaaatgacgcttactctcaccaaccatgatcag
aaaccacgcgtcgtcgaggggatgtggcacacctacctgcgcgtcgcagatgccgcacag
gcacgggtcaggggcgttcgcggcgccagctggcacaacttcgcgaccggcgacaagggg
tccttcgacgccaacgagcttgccgtagctcctgatactgacaccgtcatccagggagtc
gggcccgccctagccctcctcgattcagcgtggggacgccagatccacgtggagacaaca
gggtgtcccagtgccgtggtctggaatccacgctcctcgtcgacacatgccgataacccg
acagcccaggcatggcgcgatttcgtatgcgtcgagaccggggcctgcaaggacaatgcg
gtcattgttgccccacacagcgacctcaccatgtccacacggatcagcgtcgaaacgttg
tga

DBGET integrated database retrieval system