KEGG   Propionibacterium acnes C1: PAC1_10605Help
Entry
PAC1_10605        CDS       T02330                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pacc  Propionibacterium acnes C1
Pathway
pacc00860  Porphyrin and chlorophyll metabolism
pacc01100  Metabolic pathways
pacc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAC1_10605
Enzymes [BR:pacc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PAC1_10605
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PAC1_10605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_binding_3 Pyr_redox_3 Pyr_redox_2 Pyr_redox HI0933_like Shikimate_DH Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AFU41863
Position
2225948..2227318
Genome map
AA seq 456 aa AA seqDB search
MAVIGAGMTGLAAAHHLHSHGCRPVVLEAGQGVGGQVRSRRLGSDVVDMGPEAVPLRAPG
VAALVAELGLTDSMRHPVPGRVLLSSRRGVVEMPSGVTPVGPTKFLPTIASRILSPAGLL
RAGLEPFNAHPHLDDVSVGQFIAERFGDEVSRAVVDPLLGGIHAADLNTFSLAVAAPALE
QTVRNGDSIVAGTLKRNAAGRWSQLRHHSQRSGPRTPATATWKHGLMMLPEALARELTIH
TNTRARGIRQVGHEWVVDVTGPHGVGSVAVDDVIIATPARVAGALLATACPRASELLSQC
ESTTVATLVMQADLTDHPIATAQTWFIGSAWSALVRQVTNLSTTWHLAKPTFRIAMGRQR
GTPIDDLSDDDLVAMSVAELRRLGLALDPHDYVIERHRGAMPQPAPGHRERMAQLAATLN
GTGLHVGGAGIDGAGVGTAIAAGRRLARHITSKEEN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcatcggtgccggaatgacgggcctggcagccgcacaccacctacacagccac
ggctgtcgtcccgtcgtcctcgaagcggggcagggcgttggcggccaggtcaggtcccgt
cgtcttggttctgatgtggtcgacatgggacctgaagccgtgcctcttcgcgccccgggc
gtcgccgcactcgttgcggagctgggactaacggactccatgcgtcatcccgttcctggg
cgcgtcttattgtcgagccggcgtggagtcgtcgagatgccgtccggcgtaacaccagta
gggcccacgaagttcctccccactattgcctcgcgcatcctctcccctgccggactgtta
cgggccgggctcgaacctttcaacgctcacccgcaccttgacgacgtcagcgtcggccaa
ttcatcgccgaaagatttggtgacgaggtgagccgcgccgtcgtcgacccgctactgggg
ggtattcacgccgccgacctcaacacgttctcgctagcagttgccgcccccgctttggag
cagacggtcaggaacggcgactccatcgtcgccggaactctcaaacgcaatgctgccgga
cggtggtcgcagctccgccatcattcacagcgatccggtccgcgcacccccgccaccgcc
acctggaaacacggcctgatgatgttgccggaagcattggctagggagctcaccattcat
acgaatacccgtgccaggggaatccgtcaggtcggccacgaatgggtagtcgatgtcact
ggtccgcatggcgttggatcggttgctgttgatgacgtcatcattgccacccccgccagg
gttgcgggtgccctgcttgctaccgcatgcccgcgagcttccgagctgctgtcgcagtgt
gaaagcactaccgttgccacgctggttatgcaggctgaccttactgaccacccgatcgct
acggcccaaacgtggttcattggttcggcatggtctgccctggtgcgtcaagtgaccaat
ctctcgacgacgtggcacctcgccaaacccacctttcggatcgccatgggtcggcagcgt
ggaacccccatcgacgatctatctgacgacgacctcgtcgccatgagcgtggcagagttg
agacgtctcggactggctcttgacccccacgactacgtcattgagcgacaccgcggcgcc
atgccgcaaccagctcctggccaccgggagcgcatggcccagctcgccgcgaccctcaac
ggcaccggtctccatgtgggaggggccggtatcgacggtgccggagttggcaccgcaatt
gctgctggacgccgtctcgcacgccacatcacctcgaaggaggagaattag

DBGET integrated database retrieval system