KEGG   Propionibacterium acnes C1: PAC1_10795Help
Entry
PAC1_10795        CDS       T02330                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
pacc  Propionibacterium acnes C1
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:pacc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pacc00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pacc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2255609..2256691
Genome map
AA seq 360 aa AA seqDB search
MFTWTVSVVPHARSQSVRLSQGPIQRKLGLADIDVHTSSGPVTVSCPHLDAMDAQVFAVG
QMDPPVPPVAGNCHPSLPRTNHLPLRLSTMNKVLGIDVGGSGIKGAPVDLEVGDFAEPRL
RIPTPEKSSPENIVTVLREIVDNFAPTIGDGPVGISFPAPARHGVIPFIANLDQGWAGLH
AEKYISDALGRPVTVLNDADAAGVGEVHYGAARGVPGVVVLTTLGTGIGSAVINNGILLP
NTELGHLEIDGHDAEKRAASSVKDRKHMSYKDWATKRLQRYYEVVEMLFSPDLFVVGGGI
SKDHKKFFKYLKLETPMVPAQLLNRAGIIGAAWQAQWRLEHPDATEEEVVKAAKKAKDAD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgtttacctggaccgtcagcgtcgttcctcatgctcggtcgcagtcggtaagactgtcc
caggggccgatacaacgcaaactcggcttggctgatatcgacgtgcatacctcgtctggc
ccagtgacggtttcctgtccccacctcgacgccatggacgcccaggtcttcgccgtcggt
cagatggatccgcccgtgccgcccgtggccgggaactgtcacccgagtctcccccgcacc
aaccatctaccgttacgcttgtccaccatgaacaaggtgctgggaattgacgttggtggt
tccgggatcaagggagccccggttgacctcgaggtcggagactttgccgaaccgaggctt
cgcattcccaccccggagaagtcgtcccccgagaacatcgttaccgtgctgcgtgagatc
gtcgacaatttcgcccccaccatcggtgacgggccggttggcatctctttccccgccccg
gcacgccacggcgtcattcccttcatcgctaacctcgatcagggttgggccggcctgcac
gccgagaaatatattagtgacgctctcggccgcccagtgaccgttcttaacgacgccgac
gccgcaggtgtgggcgaggtccactacggcgctgcgaggggagtacctggcgttgtcgtt
ctcaccactctgggcaccggcatcggctctgccgtcatcaataacggcatcctgctgccg
aacaccgagcttgggcacctcgagattgatggtcacgacgccgagaagcgcgctgcctcc
tcggttaaggatcgcaagcacatgtcttacaaggactgggcaaccaagcgtctgcagcgt
tactacgaggtcgtcgagatgctcttttcccccgatctctttgtcgtcggtggcggtatc
tctaaggaccataagaagttcttcaagtacctcaagctcgagacgccgatggtgcccgcc
cagttgttgaatcgagctggcatcatcggtgcggcctggcaggcccagtggcgtctagag
catcctgacgccaccgaggaagaggtcgtcaaagctgccaagaaggcgaaggacgctgac
tga

DBGET integrated database retrieval system