KEGG   Propionibacterium acnes C1: PAC1_11010Help
Entry
PAC1_11010        CDS       T02330                                 

Definition
lipoprotein YbbD
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pacc  Propionibacterium acnes C1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pacc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pacc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2300143..2302032)
Genome map
AA seq 629 aa AA seqDB search
MKRRTVMAAAAGAFAASALPLSRAAADDTRSQLASMTLDQKIGQVLWTHVFGASADDASM
ARKNQLAFGDDVRTPAQAVQKYHLGGVLYFNWSGNISTPTNPAAVAHLSNGLQEAARTSS
TAPLAIAVDQEGGIVARITSPATEFPGNMALGAVNDPRAARAQGAVLGRELAALGINVDF
APDVDVNTNPANPVIGVRSMGDDPVRVGVLGVEQIRGIQSRGVAATAKHFPGHGDTQIDS
HLGLPVVEYGRTTLERHLVPFRMAISAEVDMIMTAHIIVKTLDPTMPATLSKKVLTGLLR
EQMGYRGIITTDALDMEGAQLAVMTEDEKGTYTRLKAAADAEGNDPTAADEGHASAEFNA
FMKPIRGRVAVQAFEAGSDILLNPHDADAVVTAMRRAIADGRVSERRLDESVLRILSWKR
RRCITGRPVDLAAADREVRSGRKVADDIAARSVTMLVNDGTLPLKPSRVLVTGTRRGNPE
YLVEPLRLAGFTPILVPSTGQEPTTADVEKAVTVGVDAVIVVTHGLKRGDAQDAMVKALA
RTGNPVVEIMTGTPYDVAMTHRPHAALAVYSNRKVSMVAAVAMMAGRNPVGRLPVRVPDP
NGGTAFPRGFGLSYRATPGPYEGPGAKTA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgacgcactgtcatggccgccgcggctggagcctttgcggcatcagcccttccg
ctgtcgcgagcggcagcggatgacacccggtctcagctcgcctccatgaccttggaccag
aagatcggtcaagtgctatggacccatgtcttcggtgccagcgctgacgacgcttcaatg
gcgaggaagaatcagctggcctttggcgatgacgtccgcactccggcccaggccgtgcag
aagtaccaccttggcggggtgctgtacttcaactggtccggtaacatctcgacgcccacg
aatccggccgccgtcgcccacctttccaacggcctgcaagaggcggcgaggacgtcgtcg
acggcgccgttggccatcgctgtcgatcaggagggcggtatcgtcgcgcggattacctcc
ccggccaccgaatttccagggaatatggcgctgggtgctgtcaatgacccgcgcgctgcg
cgtgcccaaggcgcggtgctcggtcgcgagctggctgccctgggcattaacgtggacttc
gccccggacgttgacgtcaacactaacccagccaatcccgtaatcggggtgaggtccatg
ggggacgatccggtgcgcgtcggggtactcggcgtcgagcagattcgcggcattcaatcc
agaggggttgcggccaccgccaagcatttcccaggtcatggtgatacccagatcgactcc
catcttggtcttccggtcgtggagtacggtcgcactaccctggagcgtcacctggtgccc
ttccgcatggcgatcagcgcggaagtggacatgatcatgacagcccacatcatcgttaag
accttggacccgacgatgccggccaccctgtcgaagaaagtgcttactggcctgctgcgc
gaacagatggggtatcgcggcatcatcaccaccgacgccctggacatggagggcgcccag
cttgcggtcatgaccgaggacgagaagggcacgtataccaggctcaaggctgctgccgac
gccgagggcaatgaccccacggcggccgatgaggggcatgcgagtgccgagttcaacgcc
tttatgaaaccgatccgggggcgtgttgcggtgcaggctttcgaagccggatccgacatt
ttgctgaacccccatgacgctgatgccgtcgtcacagcgatgcggagggctatcgcggac
ggtcgggttagcgagcggcgtctcgacgaatcggtgctgcgcatcctctcttggaagcgg
cgtcgctgcattacgggcaggccggttgacctcgcggcggccgatcgtgaggtacgatct
ggccgcaaggttgctgacgacatcgctgccaggtcggtgacgatgctggtcaatgacggc
actctgccgctcaagccgtcacgggtgctcgtcaccggaacacgtcggggtaatccggag
tacctcgtcgagccgttgcgcttggccggattcaccccgattcttgttccgtcaaccgga
caggaaccgacgacagccgatgtcgagaaagcggtgactgtcggtgttgatgccgtcatc
gtggtcacgcacgggttgaaacgtggagatgcccaggacgccatggttaaggctctggcg
cggaccgggaatccggtcgtggagattatgacagggaccccgtacgacgtggcgatgact
catcgcccgcatgccgcactagctgtctactccaaccgcaaggtgagcatggttgcggct
gtcgcgatgatggctggacgaaacccggtggggcgacttccggtacgggtgcccgacccg
aacggaggcacagcttttccgcgcggtttcgggctcagctaccgcgcgacgcccggaccc
tatgagggcccgggcgcgaagactgcttga

DBGET integrated database retrieval system