KEGG   Propionibacterium acnes HL096PA1: PAGK_0328Help
Entry
PAGK_0328         CDS       T02638                                 

Definition
putative protoporphyrinogen oxidase, HemY
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pach  Propionibacterium acnes HL096PA1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAGK_0328
Enzymes [BR:pach01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PAGK_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(375787..377217)
Genome map
AA seq 476 aa AA seqDB search
MNISDPQHVDAVVIGGGMAGLVAAWQFTQEGLHPVLVESRGYTGGLIARSTLAGISYDIG
AEGWAVRLPDTAELATELGLTVEKPTIAPSWVYFDDACFAMPDNAILGIPANLSDPVVII
ALGAEEAARAAELDRAPMPEDLPRDLGTLVASRMGSEVLRRLVTPIAGGIHAADPHLLSV
DVVSPGLRAATQATGSLAAGVALCRSRMPAGPAVASVAGGMFIMPAELRRQAEQAGATTM
TRVGARGLTRHGDQWLVETAGTSRNPDPSLPPVTDGEIRSFLTPRVVVACSAGPATKLLS
NVIDTVGPELAPGAPIGHVNLALQAPALDSSPRGNGMLVAPGTTTVTAKALTHMSAKWPS
LRESCPEGLHLLRVSYGRSGEANVALSVDQALTDASVLLGVDLSAEQVVDSQIIHWTGSL
APTTPQARAWRDGLHRQLEVLNQSGQGRIGLVGSWASGSGIAALVPQARRTVRQLV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttctgatccgcagcacgtcgacgccgtcgtcattggcgggggcatggctggc
ctcgtggccgcctggcagttcacccaggaaggtctgcacccggtacttgtcgaatcccgc
gggtacaccggcgggctgattgccaggtcgacgctggccggaatcagctacgacatcggg
gccgaggggtgggcggtccgtctaccagacaccgctgaactggccaccgagttgggattg
acggttgagaagccgaccatcgccccgtcttgggtgtacttcgatgacgcctgcttcgcg
atgcccgataatgccattcttggcatcccggcgaacttgtcggacccagtcgtcatcatc
gccctgggagcggaagaggctgcccgcgccgccgaacttgatcgcgcacccatgcctgag
gatctccctcgcgacctgggtacgctcgttgcctcccggatggggtcagaggtattgcgg
cgtctcgtcaccccgatcgccgggggaatccacgccgccgacccacatctactgtcagtc
gacgtcgtctcccccggtctgagggccgccacccaggccaccggatcgctagcagcggga
gttgcgctgtgccgctcacggatgccagcggggcctgcagtcgcgtcggtagccggtggc
atgttcatcatgccggccgagctgcgtcgtcaggcagaacaggccggcgcgacgaccatg
acccgagtaggagctcgcgggctaacccgccacggagatcagtggctagtggagaccgct
ggtacctcccgcaatccggatccatctttgccccccgtcaccgacggcgagattcgttcc
ttcctgacccctcgggtcgtcgtggcctgttcggctggacctgccacaaaactgctcagc
aatgtcatcgacaccgttgggcccgagttggcaccgggcgcgccgatcggccacgtcaat
ctcgccttgcaggcacccgcgctggactcgagcccacgcggaaacggcatgctggtggcc
cccggaacgaccaccgttactgccaaggcacttactcacatgtcggcgaagtggcccagc
ttgagagaatcgtgtcccgaaggtctccacttgctacgggtttcctatggtcgatctggt
gaagcgaatgtcgctttgagcgtcgatcaggctctaacggacgcttccgtcctactcggc
gtggacctctcggcggagcaggtcgtagactcccagatcattcactggacaggttccctc
gcaccgacgactccacaggcccgagcatggcgcgatggtctgcaccgccagctagaggta
ttgaaccagtctggacagggacggatcggcttagtggggtcgtgggcatcgggttcgggc
attgccgctctggtgccgcaggcccgccgaactgtccgtcaacttgtctga

DBGET integrated database retrieval system