KEGG   Propionibacterium acnes HL096PA1: PAGK_0731Help
Entry
PAGK_0731         CDS       T02638                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pach  Propionibacterium acnes HL096PA1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pach03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
832995..833765
Genome map
AA seq 256 aa AA seqDB search
MLELPEVETVRAGLEQFVVPVVVDSVDVVDTRGLRPSGGLEDAALFETTLSGRQFTAVNR
RGKYLWFILDDGTAMLAHLGMSGQFRVSTQHAPQHRHTRIVITLDDGRDLRFLDQRTFGG
LTLAPLVDGIPGPVTHIAPDPFEECFDVDEVVRRLCARRSAIKRSLLDQTLVSGIGNIYA
DETLWRVRCHPETPCSRLSQSEAVELLQTACDVMAEAMSQGGTSFDSLYVNVNGESGWFS
RVLDAYGREDEPLPPM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgagctccccgaggtcgagaccgttcgagccggactcgaacagttcgttgttccg
gttgtcgtcgacagcgtcgacgttgtcgatactcgcgggcttcgccccagcggtggactc
gaggacgctgcgcttttcgagacgaccttgtcgggtcgtcaatttactgccgtaaatcgc
cggggtaagtacctgtggttcatccttgacgatggcaccgcgatgttggctcatctaggt
atgagcggacaattccgtgttagcacccaacatgccccgcagcatcgccatacccgtata
gtcatcaccctcgacgatggtcgtgacctgcgcttcctcgaccagcgcaccttcggcgga
ttgaccctagccccgctcgttgatggtattcccggtccggtgacccacatcgcccctgat
ccgttcgaggagtgtttcgacgttgacgaggtagtgcgacggttgtgcgcacgcaggtcc
gccattaagaggagtttgctcgatcaaacccttgtttccgggattggcaatatctatgcc
gacgaaactctttggcgggtccgttgtcaccccgagacaccatgctctcgcctgagtcaa
tccgaagcggtggaattgttgcagacggcctgcgatgttatggcagaggccatgtctcag
ggcggtacctctttcgactctctttatgtcaacgtcaacggggaatcggggtggttttcc
cgtgttttggatgcctacggccgtgaggatgagcccctgccaccgatgtga

DBGET integrated database retrieval system