KEGG   Propionibacterium acnes HL096PA1: PAGK_0813Help
Entry
PAGK_0813         CDS       T02638                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pach  Propionibacterium acnes HL096PA1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pach00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PAGK_0813
Enzymes [BR:pach01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PAGK_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(909760..911049)
Genome map
AA seq 429 aa AA seqDB search
MTSTYSVVDLIRAKREGQTLNSDQIAWLIRAYTDDIVADEQMSAMAMAVYFQGLDDAELS
AWTTAMIKSGERMSFAGLSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGH
TGGTLDKMEAIPGWRADLSHDEMVAQLEKVGAVICAAGPGLAPADKKLYALRDVTGTVES
IPLIASSIMSKKIAEGTDSLVLDVKTGSGAFMKTDKDARELASRLVELGEAAGVRTTALL
THMDVPLGYACGNGIEVAESLEVLAGGGPADVVELTVALARHMVKVAGLDGIDPADVLAS
GQAMDVWRNMVRAQGGDPDAPLPMAHHTQDIVATEAGVITGIDAMSVGLAAWRLGAGRAR
KEDPVQAAAGIMLRVRPGDRVVTGQPLATLLTDTPDSIARAEDAMTNAFTVGQTFQPQDI
VIDTVVAQS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcacctattccgtcgtcgaccttatccgcgctaagcgcgaaggccagactctc
aactccgaccaaatcgcatggcttatccgcgcctacaccgacgacatcgtcgccgacgag
cagatgtctgccatggcgatggcggtgtacttccaggggctcgacgacgctgagctgtca
gcctggacgacggccatgatcaagtcgggcgagcggatgtccttcgctgggctgtcccgc
cccactgtcgacaagcactccactggcggcgtgggcgacaaaattaccttgccgctggct
cccctggtggccgcgtgcggtgctgccgtcccacagctgtctgggcgtggcctgggccac
accggaggcaccctcgacaagatggaggccattcccggatggcgggcggatctctctcat
gacgagatggtcgcccagctcgagaaagtcggcgccgtcatctgcgcagcgggcccggga
ctagcccctgctgacaagaagctctacgccctgcgcgacgttaccggcaccgtcgagtcc
atcccgctgatcgcttcgtccatcatgagcaagaagatcgcagagggcaccgacagcctc
gtcctcgatgtcaagaccggctcgggtgccttcatgaagacagataaggacgcccgcgaa
ctcgccagccgtctcgtcgagctaggtgaagccgccggggtgcgtaccaccgccctactg
acccacatggacgtcccactgggttacgcctgcggtaacggcatcgaggttgccgaatcc
ctcgaggtgttagccggcggaggtcctgccgacgtcgtcgagctcaccgtcgccctggcc
cgtcacatggtgaaggtggctggattggacggcatcgacccggccgatgtactcgccagt
ggccaggcaatggatgtctggcgcaacatggttcgtgcccagggcggcgaccctgacgct
ccactaccgatggcccaccacacccaggacatcgtcgccaccgaggctggcgtcatcacc
gggattgatgccatgtccgttggcctagctgcctggcgtttgggtgccggacgcgcccgc
aaagaggatccggtgcaagctgcggctggcatcatgttaagagttcgccccggcgaccgc
gttgtcacaggccagccattggccaccctgctcaccgacacccccgactccattgcgcgg
gccgaggatgccatgaccaacgcgttcaccgtcgggcaaaccttccagccgcaagacatt
gtcatcgacaccgtcgtagcccagtcgtga

DBGET integrated database retrieval system