KEGG   Propionibacterium acnes HL096PA1: PAGK_1102Help
Entry
PAGK_1102         CDS       T02638                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pach  Propionibacterium acnes HL096PA1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pach00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PAGK_1102
Enzymes [BR:pach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PAGK_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1232180..1232830)
Genome map
AA seq 216 aa AA seqDB search
MAELVFHTGPMDSGKSTLALQMDHAQSAHDRQGVRYAMHDRSGGARITSRIGLSVEAVEV
TDSLDLYQDIVSRLSRGGRIDYLICDEAQFYRTKQIDQLARVVDDLDIDVYCFGILADFR
TELFPGSKRLVELADRVVEPPVSPLCWCGRPATHNARIVDGKLVREGDQVGVGDIGGGSE
IHYEVLCRRHHRQGITGEISRATLSEQTLPFDGSRS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcttgttttccacaccggtccgatggactctggcaagtccaccctcgcactg
cagatggaccatgcgcagtccgctcacgaccgccaaggggtgcgatacgcgatgcacgac
cgctctggtggagctcggatcacctcgcggattggtttgagtgtcgaagctgtcgaggtc
actgactccctggacctctaccaggacatcgtctcgcggctgagtcgcggaggacgaatt
gattacctcatttgcgacgaggcccagttctaccgaactaagcagatcgaccagctggct
cgagtcgtcgatgacctcgacatcgacgtctactgcttcggaatcctggccgattttcgg
acagagctatttcccggatcaaaacgtctcgttgagttggccgaccgcgtcgttgagccc
ccggtctcgccgttgtgctggtgcggccgtcctgccacccataatgcccgcatcgtggat
gggaagttggtgcgtgagggtgaccaggtcggcgtcggagacatcggtggtggatcagag
atccattatgaggtgctatgccgccgtcaccaccgtcaagggattaccggggaaatttcc
agggcgaccttgtcggagcagaccctaccttttgatggctccaggtcctga

DBGET integrated database retrieval system