KEGG   Propionibacterium acnes HL096PA1: PAGK_1301Help
Entry
PAGK_1301         CDS       T02638                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pach  Propionibacterium acnes HL096PA1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pach00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAGK_1301
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAGK_1301
Enzymes [BR:pach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PAGK_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1445524..1446699)
Genome map
AA seq 391 aa AA seqDB search
MTDQRGAICGAATLVVKVGSSSLTLPGGGIDVRRVDDLVDALSEVIAVGRRVVLVSSGAI
ATGFPAMGITHRPRTLAGKQAAASVGQGILLAHYASRFASHGLRVGQVLLTVNDLVRPTS
YRNAWSTLDTLLGLGVVPIVNENDTVATGEIRFGDNDRLAALVAELVRAQALILLSDVDA
LYTAHPDSPDARRVEVVEDIDTLDVDTHKAGSGVGTGGMTTKLEAARMATCAGVPVVLAA
AVDAPDVLAGAPVGTYFRPLATRRPRRLLWLADAATPQGQIVIDDGAVEALTQRHSSLLA
VGVTRVHGDFQAGDPVTILASDGRVVGRGIAQFSHDEVRVMRGRSSAWLAAEMGPAASRE
IIHRDAMVLSRRRKAEPSSRNQKSSGSRVTS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatcagcgtggagccatatgcggggccgccaccctggtggtcaaggtcggatct
tcctctttgactcttcctggtggcgggattgacgttcgtcgtgttgacgacctggttgat
gcgctgagtgaggtcatcgcggtcggccggcgtgtcgtcctggtgagttccggggcgatt
gccaccggatttcccgccatggggataactcatcgtccgcgcactttggctggcaagcaa
gcggccgcgtcggtgggacaaggtattttactggctcactacgcgtcgaggtttgccagt
cacgggttgcgggtggggcaggtactactcaccgtcaatgacctggtgcggcccacctcg
taccgcaatgcctggtcaaccctcgacactttgctggggttgggcgtcgtgccgatcgtc
aacgagaacgacacggtcgccaccggagaaattcggtttggcgataatgatcggcttgct
gccctggtagccgagctggtgcgcgctcaagccctcatcctgctctctgacgttgacgcc
ttgtacaccgcccatccggattcaccggatgctcgtcgcgtggaggttgtggaggacatc
gacacattggatgtcgatacccataaagctggttcgggggtgggaaccggcggcatgacc
acgaaacttgaagccgcccgaatggccacctgtgccggggtaccggtggtactcgcagcg
gcggtggatgccccggacgttctggctggtgcccccgtgggtacctacttccgcccgctg
gcgacgcgacggccccgacggttgctgtggttggccgacgctgccaccccgcagggacag
atcgtcatcgacgacggagctgtcgaagctttgacacagcgtcattcctcgttgttggcg
gtgggtgtgactcgggtacacggggatttccaagcaggcgacccagtgacgatcctggcc
tccgacggtcgagttgttggtcgcggtatcgcccagttctcccatgatgaggtgcgcgtc
atgaggggacgttcgagtgcctggctggccgcagaaatgggcccggcagcctctcgcgag
atcatccaccgcgatgccatggtgctgagtcgtcgtcgtaaagctgagccgtcgtcgagg
aaccagaaaagtagcgggtcaagggtgacgtcctga

DBGET integrated database retrieval system