KEGG   Propionibacterium acnes ATCC 11828: TIIST44_00235Help
Entry
TIIST44_00235     CDS       T01972                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pad00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    TIIST44_00235
Enzymes [BR:pad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     TIIST44_00235
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     TIIST44_00235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41304..42146)
Genome map
AA seq 280 aa AA seqDB search
MPELPEVETVRAGLEHFVVPAVVDSVDVVDTRGLRPSGGLEDAALFETTLSGRQFTAVNR
RGKYLWFILDDGTAMLAHLGMSGQFRVSPQHAPQHRHTRIVITLDDGRDLRFLDQRTFGG
LTLAPLVDGIPGPVTHIAPDPFEECFDVDEVARRLCARRSAIKRSLLDQTLVSGIGNIYA
DETLWRVRRHPETPCSRLSQSEAVELLQTARDVMAEAMSQGGTSFDSLYVNVNGESGWFF
RVVDAYGREDEPCHRCGMPIVRESFMNRSSFRCPRCQRLR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctccccgaggtcgagaccgttcgagccggactcgaacatttcgttgttccg
gctgtcgtcgacagcgtcgacgtcgtcgatactcgcgggcttcgccccagcggtggactc
gaggacgctgcgcttttcgagacgaccttgtcgggtcgtcaatttactgccgtgaatcgc
cggggtaagtacctgtggttcatccttgacgatggcaccgcgatgttggctcatctaggt
atgagcggacaattccgtgttagcccccaacatgccccgcagcatcgccatacccgtata
gtcatcaccctcgacgatggtcgtgacctgcgcttcctcgaccagcgcaccttcggcgga
ttgaccctagccccgctcgttgacggtattcccggtccggtgacccacatcgcccctgat
ccgttcgaggagtgtttcgacgttgacgaggtagcgcgacggttgtgcgcacgcaggtcc
gccattaagaggagtttgctcgatcagacccttgtttccgggattggcaatatctatgcc
gacgaaactctttggcgggtccgtcgtcaccccgagacaccatgctctcgcctgagtcaa
tctgaagcggtggaattgttacagacggcccgcgatgttatggcagaggccatgtctcag
ggcggtacctctttcgactccctttatgtcaacgttaacggggaatcggggtggtttttc
cgcgttgtggatgcctatggccgtgaggatgagccctgccaccgatgtgggatgccgatc
gtacgcgagtctttcatgaaccggagctcgttccggtgcccgaggtgtcagagactacgg
tga

DBGET integrated database retrieval system