KEGG   Propionibacterium acnes ATCC 11828: TIIST44_01225Help
Entry
TIIST44_01225     CDS       T01972                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TIIST44_01225
Enzymes [BR:pad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TIIST44_01225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(263498..265606)
Genome map
AA seq 702 aa AA seqDB search
MSLTDPHLTTLADHFGIARDYYDWKGQYTEVGEATVIAVLDGWGIDASTPERAERACHEV
TNRKWRRVLPGIVVLREGQEGRVDVHVNAGEWVEVHVVCEDGQHRECWQVDNWNPDRHVD
DRWIGEATFGIPGDLPLGYHTIVATTADHRATSTLVVSPNWLGLPRSMGSSRVWGHAVQL
YSTRSRASWGMGDFSDLADLSTWAATQGADYVLVNPLHASQVVSPIEPSPYLPCSRLFLN
PLYVRPEIIPEYADLDVYERSQARSARAQAAADVEAIDRDRSWNAKLPVLEAVHALGLEG
SRELSYQAFRRLRGTRLGDLATWCALTEVYGNDWRTWPEEYQRPSNRAVSEFVRAHEERV
DFFMWLQWIADQQLSAAQSAGRDAGMSLGLMCDMAVGVSGAGADAWMLGKLFADGVCVGS
PPDAFNQAGQEWGQPPMRPDILADLAYRPFRDMVRAALRHAGGIRIDHILGLFRLWWVPV
GLGPRMGTYIRYDHEAMVGILALEAHRAGALVVGEDLGTVEPWVRAYLRERGIMGTSVLW
FENGENGNPLPPEQWREYAMSSVATHDLPPTTGYLAGDHVEVRHELGLLTESLEHERAEV
ARQTATWIAILRERGVLVGDDPSEEDIVLAMHRMLTRTPSKVLNATLTDAVGDRRTQNLP
GTTNEYPNWRVPLSHPDGSPMWLEEVFTDERAARLSHVMNEK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacagatccccacctgacgaccctggccgatcatttcggcatcgctcgtgat
tattacgactggaagggccagtacaccgaggtcggggaggcgactgttattgctgtcctt
gacggttggggaattgacgcgtcgactccggaacgtgccgaacgcgcgtgccacgaggtg
actaaccggaagtggcgtcgagtgttgcccggaatcgtggtcctacgtgagggccaagag
gggcgggttgacgtccacgttaacgcaggggagtgggtggaggttcacgtcgtttgcgag
gacgggcaacaccgcgagtgttggcaggttgataattggaaccccgatcgccatgtggac
gatcgttggattggtgaggccaccttcggtatccctggcgatctaccgttgggctaccac
acgatcgtcgcgacgactgcggaccatcgcgcgacttctacgcttgttgtctccccgaac
tggctcggccttcctcgttcgatgggttcgtctcgggtctggggccatgccgtgcagttg
tattcgactcgctcccgcgcctcctggggaatgggcgatttttccgacctggcggacctg
tccacctgggcggccactcagggtgctgactacgtgctcgtgaatccgctgcatgccagc
caggttgtttcccctatcgagccgtcgccgtatttgccttgcagccgcctcttcctgaac
ccgctgtatgtgcgccccgagatcatcccggagtatgccgacctcgacgtctatgagcgt
tcccaggcacgctcggcccgggcccaagcagcggccgatgttgaggcgatcgatcgagat
cgttcctggaacgctaagctgccagtgctagaagccgtccatgcccttggcctggaggga
tcgagggaattgtcctaccaggcattccgccggctgcgcggtactcgtctaggagatctc
gcgacgtggtgtgcattgacggaggtatacggcaacgattggcgcacctggcccgaggag
tatcaacgccccagcaaccgtgccgtctcagagttcgtgcgagcccacgaggaacgcgtc
gactttttcatgtggctgcagtggattgctgaccaacagctttcggcggctcaatctgcc
ggacgtgatgccgggatgtcgctgggactcatgtgcgatatggcggtgggtgtttccggt
gccggagctgatgcgtggatgctcgggaagctctttgctgacggcgtttgcgtcgggtca
ccgcctgatgcttttaatcaggctgggcaggaatggggacagcctccgatgcgtcccgac
atcctcgccgatctggcatatcggcctttccgcgacatggtgcgcgccgctttgcgtcac
gctggtggtattcgcatcgaccatattctcggcctgttccggctgtggtgggttcccgtc
ggtctcggcccgcgtatgggtacttacatacggtacgaccacgaagccatggttggtatt
ttggcgctggaggcgcaccgggctggcgcccttgtcgtgggcgaggacctgggaacggta
gagccgtgggtgcgcgcctacctgcgtgagcgcggcatcatgggcacctcggtcctgtgg
ttcgagaacggtgagaatggcaatccgctgcctcctgagcagtggcgcgagtacgccatg
agttcggtcgctacccatgatctacctcccactactgggtatctggctggtgatcacgtt
gaggtgcgtcatgagctgggactactcacggaatctctcgagcacgagcgcgctgaggtg
gctcgtcagactgccacctggatcgccatcctgcgtgagcgtggcgtgttggtgggggat
gacccctccgaagaggacatcgtgttagcgatgcatcgcatgcttacccgcactccgtca
aaggtgctcaatgccaccctgactgacgcagtgggagatcgtcgcacccaaaacttgccg
ggtaccacgaatgaatatccaaactggcgggtccctctcagccatccggatggttccccg
atgtggctggaggaggtatttactgacgagcgggctgcgcgactgtctcacgtcatgaac
gagaagtga

DBGET integrated database retrieval system