KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_01595Help
Entry
TIIST44_01595     CDS       T01972                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00020  Citrate cycle (TCA cycle)
pad00640  Propanoate metabolism
pad00660  C5-Branched dibasic acid metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01200  Carbon metabolism
Module
pad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIIST44_01595 (sucC)
   00640 Propanoate metabolism
    TIIST44_01595 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TIIST44_01595 (sucC)
Enzymes [BR:pad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TIIST44_01595 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AER04844
Position
complement(344698..345873)
Genome map
AA seq 391 aa AA seqDB search
MDLYEYQARDLFEKHGVPVLRGIVAETPEQASEAAAKLGTPVVAVKAQVKVGGRGKAGGV
KIAKSPAEAAERAEAILGMDIKGHTVHKVMVAEGADIAEEYYFSILLDRGERRYLAMCSR
EGGMDIETLAKERPEALAKVPVDPIDGVDDAKAREILSEAGFPNSEQDAIVPAVLKLWET
YRDEDATLVEVNPMIKTGDGRILAIDGKMTVDNNASFRQPDRAGLVDRATTDPLELRAGE
LGLNYVKLDGNVGVIGNGAGLVMSTLDCVAYAGEDFPGSPAPANFLDIGGGASAEIMANG
LDLIMSDEQVRSVFVNVFGGITACDQVALGIKGALEKLGDKAVKPLVVRLDGNAVTEGRK
ILEEFNHPLVTMVSTMDEAASKAAELASKEA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtatgaataccaagcccgcgacctgttcgagaagcacggcgtgcccgtactt
cgaggcatcgtcgcggagactccagagcaggcgtccgaggctgcagcaaagctcggtacc
cccgtcgtcgccgtcaaggcgcaggtcaaggtgggtggccgtggcaaggctggcggtgta
aagatcgctaagtccccggccgaggcggctgaacgcgccgaggccatcctcggtatggac
atcaagggtcacaccgttcacaaggtgatggtcgctgaaggtgctgacattgccgaggaa
tactacttctcgatcttgctcgaccgtggggagcgtcgctaccttgcgatgtgctcgcgt
gagggtggcatggacatcgagaccctcgccaaggagcgccccgaggctctcgccaaagtg
ccggtcgacccgattgacggcgttgacgatgctaaagcccgcgagatccttagcgaggca
gggttccccaactctgagcaggacgctatcgtcccggctgttcttaagctatgggagacc
taccgtgacgaggatgccaccctcgtcgaggtcaacccgatgatcaagaccggcgatgga
cgcatcctggctatcgacggcaagatgactgttgacaacaacgcatccttccgccagcct
gaccgcgccggcttggtggatcgcgccaccaccgacccgctcgagttgcgtgccggcgag
ctcggtctcaactacgtcaagcttgacggcaacgtcggcgtcatcggaaacggtgctggt
ctggtcatgagcacccttgactgcgttgcgtacgccggtgaggatttcccgggatctcca
gctcccgctaacttcctcgacatcggtggcggcgcctcggccgagatcatggccaacggc
cttgacctcatcatgagtgacgagcaggtgcgttccgtgttcgtcaacgtctttggcggt
atcaccgcctgtgaccaggtggcacttggcatcaagggcgccctcgagaagttgggcgac
aaggccgtgaagccgctcgtcgtccgtctggacggcaacgctgtgaccgagggccgcaag
attctcgaggaattcaaccacccgctcgtgaccatggtctcgaccatggacgaggccgcc
agcaaggccgccgagctcgcatccaaggaggcctga

DBGET integrated database retrieval system