KEGG   Propionibacterium acnes ATCC 11828: TIIST44_01915Help
Entry
TIIST44_01915     CDS       T01972                                 

Definition
beta-galactosidase fused to beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TIIST44_01915
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TIIST44_01915
Enzymes [BR:pad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TIIST44_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415362..417128
Genome map
AA seq 588 aa AA seqDB search
MVPAGHARQGLDSGHDDDRRPSGHPVVPLHLQPVGAHRSGHHLPFQVVVKPSGNGKGPGG
VGADHSQATIFVNGWNTGVYVGDVGPQTRFVIPAGFINLHGSNTIAVAVAAKEAGSGPAS
ITVEPTHSVTGSLVGALNKAPTYSPRTPDPATGTVPSLVPLPASLKTDSGAPFALKDSTV
IVAKGQASESAKFLATILRRSTGFPLPIVSSGSGHNSVISLTVDPHTRIGTYARQEEAYS
LVSRAGSMTARAVTSHGLFDAVQTIRQLFPPFIESTRPMMRSWTAPAVTITDAPRFSYRS
VQLDPARSFLTLDEVRSVLDVMAAHKMSVLHMHLADDQGWRIQITNKGRAPGDTLDYTKL
TSVSGHTAMDTQEHGYRDELGRTGFYTQQQYRSIVAYAAARHIMVVPEIDSPAHSNAMLH
AFPELNSANSHPETTVYGTVPQNGTSAVGYSSLDVDNPKTWTALAHIFGQIAQMTPGPYL
HIGADESHSTPHDQYVRFVTRVVNLVHSLGKKPVGWNEYSIGGVTAGDAIQYWVGDTENT
RRAVRDRGAKLIISKSDAAYLDQKYTPDTAIGLVWASNGHGGLRTYYD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggtacctgccgggcatgcccgacaaggactggacagcggccacgacgatgaccgtcga
ccatccgggcatccggtggtaccgctccaccttcaacctgtcggtgcccaccggtcagga
caccaccttccattccaggtcgtcgtcaagccttctgggaacggcaagggtcctggcggc
gtgggagccgaccattcccaggcgacaatcttcgtcaacggctggaataccggcgtctac
gtcggtgacgtcggaccacagacccgcttcgtcattcccgccgggttcatcaaccttcac
ggttcgaacaccatcgccgtcgctgtggccgccaaggaagcgggttccggtcctgcgtcg
atcaccgtcgagccgacccattcggtcactgggtccctcgtcggggccctgaacaaggcc
ccgacctacagcccacggacacccgaccccgccacaggcactgtgccctccttggtgcca
ctacctgcctccctcaagaccgacagcggagcacccttcgccctcaaggactccaccgtc
atcgtcgccaagggtcaggccagcgagagtgccaagttcctggcaacgatcctgcggcgc
tccaccggcttccccctaccgatcgtctcgagcggcagcggccacaactcggtcatcagc
ctgaccgtcgacccgcacacgagaatcggcacgtacgcccgacaggaagaggcatactcg
ctcgtctcacgggccggatccatgaccgcccgggccgtgacgagccatggtcttttcgac
gccgtccagacgatccgacaactcttcccgccattcatcgagtcgacccggcccatgatg
cggtcatggacggccccggccgttacgatcactgacgcgccacggttcagctaccgcagt
gtccagcttgatccggcacgttccttcctgaccctcgacgaggtcaggtcagttctcgac
gtcatggcagctcacaagatgtcggtgctacacatgcacctggccgacgatcagggctgg
cggatccagatcaccaacaagggccgcgcacccggcgacactctcgactacacgaaactc
acctcggtgtccggacacaccgcaatggacacccaggaacacggctaccgcgatgagctg
ggtcgcaccgggttctacactcagcagcagtaccgcagcatcgtcgcctatgccgctgct
cgccacatcatggtggtccccgagatcgactcgccggcccactccaacgcgatgttgcac
gccttccccgaactcaacagtgccaactcgcatccggaaaccacggtctacggaacggta
ccgcaaaacggcactagtgccgtgggatactcctccctggacgtcgacaatcccaagacc
tggacggctctcgcgcacatcttcggccaaatcgcccagatgactcctggtccgtatctc
catatcggcgccgatgagtcccactcgaccccacatgatcagtacgttagattcgtcact
cgggtggtcaacctcgtccacagcctcggcaagaagccggttggctggaacgagtattcc
atcggcggtgtgaccgcgggcgacgccatccagtactgggtcggtgataccgagaacacc
cgtcgtgccgtcagggacagaggagccaaactcatcatctcgaagagcgacgccgcctat
ctggaccagaagtacaccccggacactgcgatcggcctcgtctgggcctcaaacggccat
ggtgggctgcgtacttactacgactag

DBGET integrated database retrieval system