KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_02280Help
Entry
TIIST44_02280     CDS       T01972                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00071  Fatty acid degradation
pad00280  Valine, leucine and isoleucine degradation
pad00310  Lysine degradation
pad00360  Phenylalanine metabolism
pad00380  Tryptophan metabolism
pad00410  beta-Alanine metabolism
pad00627  Aminobenzoate degradation
pad00640  Propanoate metabolism
pad00650  Butanoate metabolism
pad00903  Limonene and pinene degradation
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TIIST44_02280
   00650 Butanoate metabolism
    TIIST44_02280
  Lipid metabolism
   00071 Fatty acid degradation
    TIIST44_02280
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TIIST44_02280
   00310 Lysine degradation
    TIIST44_02280
   00360 Phenylalanine metabolism
    TIIST44_02280
   00380 Tryptophan metabolism
    TIIST44_02280
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TIIST44_02280
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TIIST44_02280
   00281 Geraniol degradation
    TIIST44_02280
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TIIST44_02280
   00627 Aminobenzoate degradation
    TIIST44_02280
   00930 Caprolactam degradation
    TIIST44_02280
Enzymes [BR:pad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TIIST44_02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AER04975
Position
complement(491831..492766)
Genome map
AA seq 311 aa AA seqDB search
MDEVKISGIDDVTIILDRPRAINSLSGKMLEAIGEAVKGSPRSIDLSGAGERGYCSGADI
RELRSLALKDPEAAGDWLDGEYDVDAAIAEVHSGTAHLHGISMGGGLGLALRLKRVEARD
DLVLAMPETGIGLWPDVGACFELSRAPRLVGRHIAMTGASIDAASALWAGLVDEVVDADG
EPVDVDPVACQLARDAVWIQECYDTDDPVEVCRRLADRPEPAARKTAEHIATRCPLSVAV
ALAAVVRAESASGLGEVLETDRALGRSFMRNSDFCEGVRAQLVDKDRNPHWSHESVADVP
ARQVEGMFDPS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtgaagatcagcggtatcgacgatgtcacgatcatcttggaccgtccccga
gcaatcaactcgttatctggcaagatgctggaggctattggggaggccgtcaagggatcg
ccgcgcagcatcgatctatccggtgcgggagagcgcggctactgttcgggggctgacatt
cgcgagctcagatcgttggcattaaaggatcccgaggccgctggtgactggttggatggc
gagtacgacgttgacgctgccattgctgaggtgcactcggggaccgcacatctgcacggc
atctccatgggcggcgggcttgggttggcactgcgccttaagcgggtcgaggcccgcgac
gacctcgtcctcgcgatgccggaaacgggtattggtctatggcctgacgtgggtgcgtgt
ttcgagctctctcgggccccgcgccttgtcggccgccatatagccatgaccggggcctcc
atcgatgcggcttcggcgctgtgggccggtttggtggatgaggtcgtcgacgctgacggc
gagcccgttgacgtcgatccggtcgcttgtcagttggcgcgcgatgcggtgtggattcag
gagtgctatgacactgatgatcccgtcgaggtgtgtcgtcgattggctgatcgtcccgag
ccggccgcgcgtaagacggctgagcacattgcgacgcgctgtccgttgtcggtagctgtc
gcattggccgctgtcgtgagggctgaatccgcgtcgggtcttggtgaggtgttggagact
gatcgtgctctggggcggtcctttatgcgcaattcggacttttgcgagggggtgcgcgcc
cagctggtcgacaaggaccgcaacccgcactggtcccacgagagcgtggctgacgtgccc
gctcgtcaggttgaggggatgttcgacccgtcctga

DBGET integrated database retrieval system