KEGG   Propionibacterium acnes ATCC 11828: TIIST44_03035Help
Entry
TIIST44_03035     CDS       T01972                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_03035
Enzymes [BR:pad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     TIIST44_03035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663545..664369
Genome map
AA seq 274 aa AA seqDB search
MGPLTMIIKCMSTLPGTLHSAHDGTWQVAEHGCQVLAWQADDKPVIWFDAEHAAESEAVI
RGGIPLCAPWFGHGPNNDQDPQHGLARRTDFEVTATDPFRVVGVAETASIGIRHEVVMTN
TALKMMLTLTNHDQKPRVTEGMWHTYLRVADAAQARVRGVRGASWHNFATGDKGSFDANE
LAVTPDTDTVIQGVGPALALLDPAWGRQIHVETTRCPSAVVWNPRSSSTHADNPTAQAWR
DFVCVETGACKDNAVIVAPHSDLTMSTRISVETL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccactgaccatgatcataaagtgcatgagtacccttcctggaacccttcattcg
gcccatgatggcacttggcaggtagcagagcatggctgccaagtgttagcctggcaagcc
gacgacaagcccgtcatctggttcgacgccgagcacgctgccgagtccgaggccgtgatc
cggggaggaatcccgctgtgtgccccgtggtttggtcacggccccaacaatgatcaggac
ccccagcacggcctggcccgtcgcaccgacttcgaggtaacggccactgatcccttccgc
gtcgtcggggttgctgagaccgcgtccatcggaatccgtcacgaggttgtcatgacgaac
acggccttgaagatgatgcttaccctcaccaaccatgatcagaaaccacgcgtcaccgag
gggatgtggcacacctacctgcgcgtcgcagatgccgcacaggcacgggtcaggggcgtt
cgcggcgccagctggcacaacttcgcgaccggtgacaaggggtccttcgacgccaacgag
cttgccgtaactcctgatactgacaccgtcatccagggagtcgggcccgccctagccctc
ctcgatccagcgtggggacgccagatccacgtggagacgacaaggtgccccagcgccgtg
gtctggaatccacgctcctcgtcgacacatgccgataacccaacagcccaggcatggcgc
gatttcgtatgcgtcgagaccggggcctgcaaggacaatgcggtcattgttgccccacac
agcgacctcaccatgtccacacggattagcgtcgaaacgttgtga

DBGET integrated database retrieval system