KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_03165Help
Entry
TIIST44_03165     CDS       T01972                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00860  Porphyrin and chlorophyll metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIIST44_03165
Enzymes [BR:pad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TIIST44_03165
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     TIIST44_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_binding_3 Pyr_redox_3 Pyr_redox_2 Pyr_redox HI0933_like Shikimate_DH Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AER05150
Position
687263..688633
Genome map
AA seq 456 aa AA seqDB search
MAVIGAGMTGLAAAHHLHSHGCRPVVLEAGQGVGGQVRSRRLGSDVVDMGPEAVPLRAPG
VAALVAELGLTDSMRHPVPGRVLLSSRRGVVEMPSGVTPVGPTKFLPTIASRILSPAGLL
RAGLEPFNARPHLDDVSVGQFIAERFGDEVSRAVVDPLLGGIHAADLNTFSLAVAAPALE
QTVRNGDSIVAGTLKRNAAGRWSQLRHHSQRSGPRTPATATWKHGLMMLPEALARELTIH
TNTRARGIRQVGHEWVVDVTGPHGVGSVAVDDVIIATPARVAGALLATACPRASELLSQC
ESTTVATLVMQADLTDHPIATAQTWFIGSAWSALVRQVTNLSTTWHLAKPTFRIAMGRQR
GTPIDDLSDDDLVAMSVAELRRLGLALDPHDYVIERHRGAMPQPAPGHRERMAQLAATLN
GTGLHVGGAGIDGAGVGTAIATGRRLARHITSKEEN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcatcggtgccggaatgacgggcctggcagccgcacaccacctacacagccac
ggctgtcgtcccgtcgtcctcgaagcggggcagggcgttggcggccaggtcaggtcccgt
cgtcttggttctgatgtggtcgacatgggacctgaagccgtgcctcttcgcgccccgggc
gtcgccgcactcgttgcggagctgggactaacggactccatgcgtcatcccgttcctggg
cgcgtcttattgtcgagccggcgtggagtcgtcgagatgccgtccggcgtaacaccagta
gggcccacgaagttcctccccactattgcctcgcgcatcctctcccctgccggactgtta
cgggccgggctcgaacctttcaacgctcgcccgcaccttgacgacgtcagcgtcggccaa
ttcatcgccgaaagatttggtgacgaggtgagccgcgccgtcgtcgacccgctactgggg
ggtattcacgccgccgacctcaacacgttctcgctagcagttgccgcccccgctttggag
cagacggtcaggaacggcgactccatcgtcgccggaactctcaaacgcaatgctgccgga
cggtggtcgcagctccgccatcattcacagcgatccggtccgcgcacccccgccaccgcc
acctggaaacacggcctgatgatgttgccggaagcattggctagggagctcaccattcat
acgaatacccgtgccaggggaatccgtcaggtcggccacgaatgggtagtcgatgtcact
ggtccgcatggcgttggatcggttgctgttgatgacgtcatcattgccacccccgccagg
gttgcgggtgccctgcttgctaccgcatgcccgcgagcttccgagctgctgtcgcagtgt
gaaagcactaccgttgccacgctggttatgcaggctgaccttactgaccacccgatcgct
acggcccaaacgtggttcattggttcggcatggtctgccctggtgcgtcaggtgaccaat
ctctcgacgacgtggcacctcgccaaacccacctttcggatcgccatgggtcggcagcgt
ggaacccccatcgacgatctatctgacgacgacctcgtcgccatgagcgtggcagagttg
agacgtctcggactggctcttgacccccacgactacgtcattgagcgacaccgcggcgcc
atgccgcaaccagctcctggccaccgggagcgcatggcccagctcgccgcgaccctcaac
ggcaccggtctccatgtgggaggggccggtatcgacggtgccggagttggcaccgcaatt
gctactggacgccgtctcgcacgccacatcacctcgaaggaggagaattag

DBGET integrated database retrieval system