KEGG   Propionibacterium acnes ATCC 11828: TIIST44_03565Help
Entry
TIIST44_03565     CDS       T01972                                 

Definition
glycosyl hydrolase family 3 N-terminal domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TIIST44_03565
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TIIST44_03565
Enzymes [BR:pad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TIIST44_03565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(760255..762144)
Genome map
AA seq 629 aa AA seqDB search
MKRRTVMAAAAGAFAASALPLSRAAADDTRSQLASMTLDQRIGQVLWTHVFGASADDASM
ARKNQLAFGDDVRTPAQAVQKYHLGGVLYFNWSGNISTPANPAAVAHLSNGLQEAARTSS
TAPLAIAVDQEGGIVARITSPATEFPGNMALGAVNDPRAARAQGAVLGRELAALGINVDF
APDVDVNTNPANPVIGVRSMGDDPVRVGVLGVEQIRGIQSRGVAATAKHFPGHGDTQIDS
HLGLPVVEYGRTTLERHLVPFRMAISAEVDMIMTAHIIVKTLDPTMPATLSKKVLTGLLR
EQMGYRGIITTDALDMEGAQLAVMTEDEKGTYTRLKAAADAEGNDPTAADEGHASAEFNA
FMKPIRGRVAVQAFEAGSDILLNPHDADAVVTAMRRAIADGRVSERRLDESVLRILAWKR
RRCITGRPVDLAAADREVRSGRKVADNIAARSVTMLVNDGTLPLKPSRVLVTGTRRGNPE
YLVEPLRLAGFTPILVPSTGQEPTTADVEKAVTVGVDAVIVVTHGLKRGDAQDAMVKALA
RTGKPVVEIMTGTPYDVAMTHRPHAALAVYSNRKVSMVAAVAMMAGRNPVGRLPVRVPDP
NRGTAFPRGFGLSYRATPGPYEGPGAKTA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgacgcactgtcatggccgccgcggctggagcctttgcggcatcagcccttccg
ctgtcgcgagcggcagcggatgacacccggtctcagctcgcctccatgaccttggaccag
aggatcggtcaagtgctatggacccatgtcttcggtgccagcgctgacgacgcttcaatg
gcgaggaagaatcagctggcctttggcgatgacgtccgcactccggcccaggccgtgcag
aagtaccaccttggcggggtgctgtacttcaactggtccggtaacatctcgacgcccgcg
aatccggccgccgtcgcccacctttccaacggcctgcaagaggcggcgaggacgtcgtcg
acggcgccgttggccatcgctgtcgatcaggagggcggtatcgtcgcgcggattacctcc
ccggccaccgaatttccagggaatatggcgctgggtgctgtcaatgacccgcgcgctgcg
cgtgcccaaggcgcggtgctcggtcgcgagctggctgccctgggcattaacgtggacttc
gccccggacgttgacgtcaacactaacccagccaatcccgtaatcggggtgaggtccatg
ggggacgatccggtgcgcgtcggggtactcggcgtcgagcagattcgcggcattcaatcc
agaggggttgcggccaccgccaagcatttcccaggtcatggtgatacccagatcgactcc
catcttggtcttccggtcgtggagtacggtcgcactaccctggagcgtcacctggtgccc
ttccgcatggcgatcagcgcggaagtggacatgatcatgacagcccacatcatcgttaag
accttggacccgacgatgccggccaccctgtcgaagaaagtgcttactggcctgctgcgc
gaacagatggggtatcgcggcatcatcaccaccgacgccctggacatggagggcgcccag
cttgcggtcatgaccgaggacgagaagggcacgtataccaggctcaaggctgctgccgac
gccgagggcaatgaccccacggcggccgatgaggggcatgcgagtgccgagttcaacgcc
tttatgaaaccgatccgggggcgtgttgcggtgcaggctttcgaagccggatccgacatt
ttgctgaacccccatgacgctgatgccgtcgtcacagcgatgcggagggctatcgcggac
ggtcgggttagcgagcggcgtctcgacgaatcggtgctgcgcatcctcgcttggaagcgg
cgtcgctgcattacgggcaggccggttgacctcgcggcggccgatcgtgaggtacgatct
ggccgcaaggttgctgacaacatcgctgccaggtcggtgacgatgctggtcaatgacggc
actctgccgctcaagccgtcacgggtgctcgtcaccggaacacgtcggggtaatccggag
tacctcgtcgagccgttgcgcttggccggattcaccccgattcttgttccgtcaaccgga
caggaaccgacgacagccgatgtcgagaaagcggtgactgtcggtgttgatgccgtcatc
gtggtcacgcacgggttgaaacgtggagatgcccaggacgccatggttaaggctctggcg
cggaccgggaagccggtcgtggagattatgacagggaccccgtacgacgtggcgatgact
catcgcccgcatgccgcgctagctgtctactccaaccgcaaggtgagcatggttgcggct
gtcgcgatgatggctggacgaaacccggtggggcgacttccggtacgggtgcccgacccg
aacagaggcacagcttttccgcgcggtttcgggctcagctaccgcgcgacgcccggaccc
tatgagggcccgggcgcgaagactgcttga

DBGET integrated database retrieval system