KEGG   Propionibacterium acnes ATCC 11828: TIIST44_04340Help
Entry
TIIST44_04340     CDS       T01972                                 

Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TIIST44_04340
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TIIST44_04340
Exosome [BR:pad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIIST44_04340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(932186..933709)
Genome map
AA seq 507 aa AA seqDB search
MSDEKFVLAIDEGTTSARAIIFNHAGQIVAVGQQEFEQIFPRAGWVEHDPIEIWEAVRDV
VGLALTKANINRHQLAAAGITNQRETAVVWDKNTGEPVYNAIVWQDTRTQKICNELAGDK
GADRYKEICGLGLSTYFSGPKVKWILDNVEGARARAEAGDLLFGNMDTWVLWNLTGGTNG
GVHITDPTNASRTMLMDVRKLQWDDSMCEVMGIPKSMLPEIKSSSEIYGYGRKNGLLIDT
PISGILGDQQAATFGQACFQKGMAKNTYGTGCFMLMNTGEEAIFSENGLLTTVCYKIGDQ
PTVYALEGSIAVAGSLVQWLRDNLKMFETAPQIEALANTVEDNGGAYFVPAFSGLFAPYW
RPDARGALVGLTRYVNRGHIARAVLESTAFQTREVLEAMNADSGVPLTELRVDGGMTANE
TLMQFQADQVNVPVVRPVVAETTALGAAYAAGIAVGFWEGENDVTDNWAEDKRWEPKMDE
SERERLFRNWKKAVTKTFDWVDDDVKE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgagaagtttgtactcgccattgacgagggcactacttccgcccgtgccatc
atctttaaccacgccggccagatcgtggccgttggccagcaggagttcgagcagatcttc
ccgcgtgctggatgggttgagcatgacccgatcgagatctgggaggccgttcgcgacgtc
gttgggctcgccctgaccaaggccaacatcaaccgccaccagctggctgctgctggtatc
accaaccagcgcgagaccgcagtggtgtgggacaagaacaccggtgagccggtttataac
gccatcgtgtggcaggacacgcgcactcaaaagatctgtaacgaactagctggtgacaag
ggcgccgaccgctacaaggagatctgtggtctgggcctgtcgacctatttctctggcccg
aaggtcaaatggattctcgacaacgttgagggagcccgtgcgagggccgaggccggcgat
ctgctcttcggtaacatggacacttgggtgctgtggaacctgactggcggtactaacggt
ggcgtgcacatcaccgatccgaccaacgcgtcccgaaccatgctcatggacgtccgaaag
ctgcagtgggacgactcgatgtgcgaggtcatgggaattccaaagtccatgcttcctgag
atcaagtcctcctccgagatctacggctatggtcgcaagaacggcctgctgatcgatacc
ccgatctccggcattcttggcgatcagcaggccgccacctttggccaggcttgcttccaa
aagggcatggcgaagaacacgtacggcaccggctgcttcatgctcatgaacacaggtgag
gaggccatcttctccgagaacggtctgctgaccaccgtctgctacaagattggtgaccag
cccaccgtctatgccctggaaggttcgatcgccgtcgctggatcgctggtacagtggctg
cgcgacaacctcaagatgttcgagaccgccccgcaaatcgaagccctcgccaacaccgtc
gaggacaatggtggcgcctactttgtgccggccttctctggcctgttcgcgccgtactgg
cgtccggatgcccgtggcgccctcgtgggcctgactcgctacgtcaaccgtggccacatt
gcccgcgccgtgctcgagtcgaccgccttccagactcgcgaggttcttgaggctatgaac
gccgattccggtgtgccgctgacggagctgcgcgtcgacggtggcatgaccgccaacgaa
accctcatgcagttccaggccgaccaggttaatgtgccggtggttcgccccgtggtcgcc
gagaccaccgctctgggcgccgcctacgccgctggcatcgctgtcggtttctgggagggc
gaaaatgacgtcaccgacaactgggccgaggacaagcgctgggagcctaagatggacgag
agtgagcgcgagcgtctgttccgcaactggaagaaggccgtcactaagaccttcgactgg
gtggacgacgacgtcaaggagtga

DBGET integrated database retrieval system