KEGG   Propionibacterium acnes ATCC 11828: TIIST44_04695Help
Entry
TIIST44_04695     CDS       T01972                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TIIST44_04695
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TIIST44_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1014201..1015130
Genome map
AA seq 309 aa AA seqDB search
MSGATAKVTVVGSINADMRVGVERFPGPGETLAGGEATLTPGGKGANQALAAARCGVQVA
MVGAVGKDPTAETALSLLSEGVGLDGVARRDVLTGTAVVMVADSGENSIIVVAAANGTVD
AQTVRAQAERIQDADVVLCQGEIPPDGITEAARGAKRFVFNLAPVVDVDPEVIRMADPLI
VNEHEAALVALALGSTTSRLEDDPDAALRELLNLGCRSVVITLGSAGCIVGGPEGFDAVA
AATVKAVDTVGAGDAFVGALAAELARGRTLVEGCRFATAVATLTVTKPGAQASYPSADEV
ESIRRGEHA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgacagcgaaagtcaccgtcgtcggatcgatcaatgccgacatgagggtc
ggcgtggagagatttccgggcccgggggagaccttggccggaggtgaggcgacactgacc
cccggcggtaagggagctaaccaggcccttgcggcggcgcgatgtggcgttcaggtggcg
atggtcggagctgtggggaaggacccgacggctgaaaccgccctatccctactatcggaa
ggcgttggccttgatggcgtggcccgtcgtgatgtattgacggggacggccgtcgtcatg
gtcgcggattccggagagaactcgattatcgtcgtcgcggctgctaatgggaccgttgat
gcacagaccgttcgagctcaagccgagcgcatccaggacgctgacgtggtgttgtgtcaa
ggtgagattccgcctgacgggattaccgaagctgctcgcggcgccaaacgattcgtgttc
aatctggcaccggttgttgatgttgatccagaggtcattcgcatggccgacccgctgata
gttaacgaacatgaggcggccttggtggctcttgctttgggatcgacgacttctcgtctt
gaggatgatcctgacgcagctttgcgcgagctattgaaccttgggtgccgcagtgttgtc
atcaccttgggatcggccggatgcatcgtcggcgggccggaagggtttgacgccgtggct
gcggcgaccgtgaaggctgtcgataccgtcggtgcgggagatgctttcgttggtgcgttg
gctgcagaactggctcgtggccgtactcttgtcgagggctgccgttttgctaccgcggtg
gcgactttgacggtgaccaagccgggggcacaagcctcctaccccagtgctgacgaggtc
gagagcattcgtcgaggagaacacgcatga

DBGET integrated database retrieval system