KEGG   Propionibacterium acnes subsp. defendens ATCC 11828: TIIST44_05090Help
Entry
TIIST44_05090     CDS       T01972                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pad  Propionibacterium acnes subsp. defendens ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_05090
   00030 Pentose phosphate pathway
    TIIST44_05090
   00051 Fructose and mannose metabolism
    TIIST44_05090
   00052 Galactose metabolism
    TIIST44_05090
  Energy metabolism
   00680 Methane metabolism
    TIIST44_05090
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIIST44_05090
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TIIST44_05090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1098852..1099979
Genome map
AA seq 375 aa AA seqDB search
MSRKKKVGILTAGGDCPGLNAAIRGFGKAAIRQHDMELIGIQDGFLGLAGNRTISLGPRA
LSGILTVGGTILGTSRDKVNHMIIDGEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAY
KLAKAGLNVLHLPKTIDNDIVGTDDSFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMG
HRAGWLALGSGIAGGADVILLPEVPYKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADS
AAMAGAQALVDASKTPETKAAAKKAKKDLEHSMRDNTLKLATQLEEATGLESRVSILGYV
QRGGIPCAHDRLLATRLGTMGAKLVDDGEFGIMVAAQGGDATTVALKDVAGKVKYVPADH
PWVKAARQVGTGLGD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaagaagaaggtcggcatcctcaccgcaggcggtgattgccccgggctcaac
gccgctatccgcggatttggcaaggctgccatccgccagcacgacatggagctcatcggt
attcaggacggctttcttggattggcgggaaaccgcaccatctcccttggcccgcgtgcc
ctctcaggcatcctgacggtcggcgggaccatcctgggaactagccgtgacaaggtcaat
cacatgattatcgacggcgaggaacgggatatggtgcccaccatcgtcgagaattacgag
aagctggggcttgacgctttggtgactttgggcggtggtggcaccgccaagaacgcgtac
aagctcgctaaggccgggctgaacgtcctgcatctgcccaagacgattgacaacgacatc
gtcggaaccgacgactccttcgggttttcgacagcactggagattgccacggaggccatc
gaccggctgcactccaccgcccattcccaccaccgcatcattctcgctgagatcatgggc
caccgtgccgggtggttggccctcggttcgggcatcgctggtggtgctgatgtcatcctg
ctgcccgaggtgccctacaagctggactccatcgtccaggcggtggaaaaccgacaaaag
caggggttgaacttctcggtcatcgcggtggctgagggagctcgcgatgaggctgattcg
gccgcgatggccggagctcaggccctcgttgacgcttccaagacccctgagacaaaggcg
gctgccaagaaggccaagaaggaccttgagcattccatgcgcgacaataccctcaaattg
gctactcagcttgaggaggccaccgggctggaatcgcgagtctcgatcctgggctatgtg
cagcgcggtggtatcccgtgcgcccacgaccgtctgctcgcgacccggctgggaaccatg
ggtgccaagctcgttgacgacggtgagttcggcatcatggtcgccgctcagggcggagac
gccacgaccgttgcgttgaaagacgtcgctggcaaggttaaatacgtacctgccgaccac
ccatgggttaaggcggcccgtcaggtcggaaccggtctaggcgactga

DBGET integrated database retrieval system