KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_05370Help
Entry
TIIST44_05370     CDS       T01972                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00010  Glycolysis / Gluconeogenesis
pad00030  Pentose phosphate pathway
pad00051  Fructose and mannose metabolism
pad00052  Galactose metabolism
pad00680  Methane metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01200  Carbon metabolism
pad01230  Biosynthesis of amino acids
Module
pad_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_05370
   00030 Pentose phosphate pathway
    TIIST44_05370
   00051 Fructose and mannose metabolism
    TIIST44_05370
   00052 Galactose metabolism
    TIIST44_05370
  Energy metabolism
   00680 Methane metabolism
    TIIST44_05370
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIIST44_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AER05569
Position
complement(1169011..1169961)
Genome map
AA seq 316 aa AA seqDB search
MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISRVLRGAGIETCAVVPA
GAKGRLTLGLSHDDIPHLVVPVAAAVRTNLTITEPDGTTTKINEPGSDLSSEELTAVEEA
IVEKSFGAQWVVLSGSLPPGVPTHWYATMTDRLHEVGVKVAVDTSDQPLQELAVRLPDCA
PDLVKPNSVELGQLCGIDGGSLESAATRGQFDDVVVAARGLHGIAEVIVTLGGTGALLIT
EHDAWHARPEPVKVKSTVGAGDSSLAGFLLARAHGDQPENCLRAAVAWGTAAAALPGSTM
PTPSQADAIHVSLTHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaccgtcacgctcaacccgagcattgaccgcacagcgcccatagctgggccg
ctgcggcgcggtcaggtgaaccgactcggcagttccaccgaggtcgccgccggtaagggg
gtcaacatctcgcgagtccttcgtggggctggaatcgaaacctgcgccgtggtgccagcc
ggagccaagggccgcctgaccctcggcctcagccacgacgacatcccgcacctagtcgta
cccgttgcagcagcggtgagaaccaacctcaccatcaccgaacctgacggcactacaacc
aagatcaatgagcccggatccgacctcagttccgaggagctgaccgcagttgaggaggcc
atcgtcgagaagtccttcggtgcgcaatgggtcgtactgtcaggatccttacccccgggc
gtacccacacattggtatgccacaatgaccgaccgcctccatgaggtcggcgtcaaggtc
gccgtcgacacctccgatcaacccctccaagaactggcggtccgcctccccgactgtgcc
cctgacctcgtcaagccgaactccgtcgagctcggccaactatgcgggattgacggcggc
tccctcgagtccgctgccacaaggggacagttcgacgacgttgtcgtggccgcccgaggt
ctgcacggcatcgccgaggtcatcgtcaccttgggcgggaccggcgctctgctcatcacc
gagcacgacgcctggcacgcccggccagagccggtcaaggtgaagtcgactgttggcgcc
ggagactcctccctggccggattcttgctggcgcgcgcccacggcgaccagcccgaaaac
tgtctgcgcgccgccgtggcgtggggcacagcagccgccgctctaccggggtcaaccatg
ccaaccccgtctcaggcagacgccattcacgtcagcctcacccacctgtaa

DBGET integrated database retrieval system