KEGG   Propionibacterium acnes ATCC 11828: TIIST44_05370Help
Entry
TIIST44_05370     CDS       T01972                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIIST44_05370
   01230 Biosynthesis of amino acids
    TIIST44_05370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_05370
   00030 Pentose phosphate pathway
    TIIST44_05370
   00051 Fructose and mannose metabolism
    TIIST44_05370
   00052 Galactose metabolism
    TIIST44_05370
  Energy metabolism
   00680 Methane metabolism
    TIIST44_05370
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIIST44_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1169011..1169961)
Genome map
AA seq 316 aa AA seqDB search
MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISRVLRGAGIETCAVVPA
GAKGRLTLGLSHDDIPHLVVPVAAAVRTNLTITEPDGTTTKINEPGSDLSSEELTAVEEA
IVEKSFGAQWVVLSGSLPPGVPTHWYATMTDRLHEVGVKVAVDTSDQPLQELAVRLPDCA
PDLVKPNSVELGQLCGIDGGSLESAATRGQFDDVVVAARGLHGIAEVIVTLGGTGALLIT
EHDAWHARPEPVKVKSTVGAGDSSLAGFLLARAHGDQPENCLRAAVAWGTAAAALPGSTM
PTPSQADAIHVSLTHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaccgtcacgctcaacccgagcattgaccgcacagcgcccatagctgggccg
ctgcggcgcggtcaggtgaaccgactcggcagttccaccgaggtcgccgccggtaagggg
gtcaacatctcgcgagtccttcgtggggctggaatcgaaacctgcgccgtggtgccagcc
ggagccaagggccgcctgaccctcggcctcagccacgacgacatcccgcacctagtcgta
cccgttgcagcagcggtgagaaccaacctcaccatcaccgaacctgacggcactacaacc
aagatcaatgagcccggatccgacctcagttccgaggagctgaccgcagttgaggaggcc
atcgtcgagaagtccttcggtgcgcaatgggtcgtactgtcaggatccttacccccgggc
gtacccacacattggtatgccacaatgaccgaccgcctccatgaggtcggcgtcaaggtc
gccgtcgacacctccgatcaacccctccaagaactggcggtccgcctccccgactgtgcc
cctgacctcgtcaagccgaactccgtcgagctcggccaactatgcgggattgacggcggc
tccctcgagtccgctgccacaaggggacagttcgacgacgttgtcgtggccgcccgaggt
ctgcacggcatcgccgaggtcatcgtcaccttgggcgggaccggcgctctgctcatcacc
gagcacgacgcctggcacgcccggccagagccggtcaaggtgaagtcgactgttggcgcc
ggagactcctccctggccggattcttgctggcgcgcgcccacggcgaccagcccgaaaac
tgtctgcgcgccgccgtggcgtggggcacagcagccgccgctctaccggggtcaaccatg
ccaaccccgtctcaggcagacgccattcacgtcagcctcacccacctgtaa

DBGET integrated database retrieval system