KEGG   Propionibacterium acnes ATCC 11828: TIIST44_05720Help
Entry
TIIST44_05720     CDS       T01972                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pad03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248528..1249133
Genome map
AA seq 201 aa AA seqDB search
MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADALREVKEKAKFCKICF
NVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYHVLGGAISPLDGKGPAD
LHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMGVTVSRLASGLPVGGDLE
YADEVTLGRAFEGRLHVGVGA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacggtccgctgcaagaactcattgacgccctttctcggctaccggggatcggg
ccgaagggtgcgcagcggatcgcttttcatatcctcgacgctcctgcggaggaagccaat
gaactggccgacgccctgcgcgaggtcaaagagaaggccaagttctgcaagatttgtttt
aatgtctcttccgacgaggtgtgccagtactgccgtgatccgcgtcgggaccagtcgatg
atctgtgttgttgaggagtccaaagacgttattgctgtggagcgtacccgacaattccgt
ggtctgtatcacgttcttggcggagcgatctcgccgttagacggaaaaggtccagctgat
ctccacatccgtgaattgtgccagcggttggctgacgaaaccgttaccgaggtgatcctg
gccaccaacccgaaccttgagggggaagcaacggcaacgtatctttctcgcctcatcgcg
cccatgggcgtgacggtgtcccgactagcctctggtttgccggttggcggcgatctggaa
tacgccgacgaggtcaccctggggcgcgccttcgagggacgtctccatgtgggggttggt
gcctga

DBGET integrated database retrieval system