KEGG   Propionibacterium acnes ATCC 11828: TIIST44_06005Help
Entry
TIIST44_06005     CDS       T01972                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIIST44_06005
Enzymes [BR:pad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TIIST44_06005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1308192..1308761
Genome map
AA seq 189 aa AA seqDB search
MSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI
SHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQ
ERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATRAE
AMGLITAGR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgttgatcgcgagcgagccgcggcagctatccgcgagtttcttctggcggtcggc
gaggatcccgatcgggaaggtctgcgcgatactccaatgcgagtggcccaggcggccgag
gagctatttggcggattaagccaagatccgggggagttgctggcaacgaccttcgacatc
tcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgagcaccac
ctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggccgggtg
acggggttgagcaagatcgcgaggttggtggaggtctatgcgcgtcgaccccaggtacag
gagaggttgacgacccaggtggccgacgccttggtagaacatttggatgctcgtggcgtg
atcgtggtcgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaagccgggg
gcccggacggtgacctccgcggtgcgcgggattctgcgcaacccggcgacgcgggccgag
gcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system