KEGG   Propionibacterium acnes ATCC 11828: TIIST44_06050Help
Entry
TIIST44_06050     CDS       T01972                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIIST44_06050
Enzymes [BR:pad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TIIST44_06050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314192..1315037
Genome map
AA seq 281 aa AA seqDB search
MINVGSATNSHPARTLVMGVVNVTPNSFSDGGMWADPEVAIRHARDLVVEGADIIDVGGE
STRPGTERTPEHEELRRVLPVVKALVADGVAVSVDTMRASVAKAVVEAGATIVNDVSGGK
AEPEILDVVADAGVDYVLMHWRGQSATMQNLVDYDDVVADVISETSQQVDAAIAAGIDRR
RIIVDPGIGFSKTSEHNWQLINAVDAFQEGFADLRVLWGVSRKRFLGELLAQNGEDRPAL
ERDASTMALSTYFALHHAWCVRTHEVRANRDAVETVARLLA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgtcggctcggctaccaactcgcatcccgcccgcaccctcgtcatgggggtc
gtcaacgtcactcctaactcgttctctgacggaggcatgtgggccgatcctgaggtggcc
atccgccacgctcgcgacctcgttgtcgaaggagctgacatcatcgacgtcggtggtgaa
tccacccgtccgggcaccgaacgcacccccgagcacgaagaattgcgccgcgtcctgccc
gtcgtcaaagctttggtggccgacggggtcgccgtctccgtcgacactatgcgcgcctca
gtggccaaggccgttgtcgaggcaggagccaccatcgtcaacgacgtctctgggggcaag
gctgaaccggaaatccttgatgtcgttgccgacgctggcgtcgattacgttctcatgcac
tggcgcggtcaatccgccactatgcagaaccttgtcgactatgacgacgtggtagccgac
gtcatctctgagacctcccagcaggtcgacgcagctattgccgctggaatcgaccgtagg
cgcatcatcgtcgacccgggcattggtttctccaagacttccgagcacaactggcagctc
attaacgccgttgacgccttccaagaaggatttgccgaccttcgtgtcctgtggggagtt
agtcgcaagcgtttccttggtgaactcctcgcccagaacggggaggaccgtccggccctc
gaacgcgatgcgagcaccatggccctgtcgacttatttcgcccttcatcacgcctggtgt
gtgcgcacccacgaagttcgggccaaccgcgacgccgtggagaccgttgcccgccttctc
gcctga

DBGET integrated database retrieval system