KEGG   Propionibacterium acnes ATCC 11828: TIIST44_06215Help
Entry
TIIST44_06215     CDS       T01972                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIIST44_06215
Enzymes [BR:pad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TIIST44_06215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1346058..1346783)
Genome map
AA seq 241 aa AA seqDB search
MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVTLPDAEGLTTPDLWHA
DWLVVTSKTTVGLLPTPLPNPNIKVAAVGVATSAALRTRGIDVDFVPDDHSGAGLVAEWP
GGTASILLPTSQLAADTVPLGLTKIGCTVNRLEVYTTAAVEKLPEVIAQSWPSVGVGVVT
ASSVGRALVELVEPLGWRHQKLVALGKPTARTLEELGHPAHAVASSPTPEAVLEAVESLV
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaaccctgccgatctcgtcaagcccccggttgtcgttccccgcgacgactcc
cacgacaaattcgtgacgactttgaagcaggccggttatggagtgatccacacagcgctg
acgcgcaccgtcaccttgccggacgcagaggggctcactacccctgacctgtggcatgcc
gactggctggtcgtcacctcgaagaccaccgtcggactgctccctaccccgttgccgaat
cccaacatcaaagtagccgcggtcggtgtcgctacctccgctgcgctgcgcacacgtggg
attgacgtcgacttcgtccccgacgatcacagcggcgctggtctggtcgccgagtggcca
ggcggaaccgccagcatcctcctaccaacgtcccagttggccgccgacaccgtaccgctg
ggactaacgaagatcggctgcacggtgaaccgattggaggtctacaccaccgctgccgtc
gagaaactacctgaggtcatcgcccagtcgtggccgtctgtcggggtcggcgtcgtcact
gcctcctcggtgggacgtgccctcgtcgagctggtggagccgctgggatggcgtcatcag
aagctcgtcgccctcggcaagcccactgcaagaacactcgaggagctcggtcacccagcg
catgcggtggcctcctcccctactcctgaagccgtccttgaggcggttgagtccttggtc
gcctga

DBGET integrated database retrieval system