KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_06535Help
Entry
TIIST44_06535     CDS       T01972                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00010  Glycolysis / Gluconeogenesis
pad00260  Glycine, serine and threonine metabolism
pad00680  Methane metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01120  Microbial metabolism in diverse environments
pad01130  Biosynthesis of antibiotics
pad01200  Carbon metabolism
pad01230  Biosynthesis of amino acids
Module
pad_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pad_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_06535
  Energy metabolism
   00680 Methane metabolism
    TIIST44_06535
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIIST44_06535
Enzymes [BR:pad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TIIST44_06535
Membrane trafficking [BR:pad04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TIIST44_06535
Exosome [BR:pad04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TIIST44_06535
  Exosomal proteins of melanoma cells
   TIIST44_06535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AER05788
Position
complement(1406655..1407404)
Genome map
AA seq 249 aa AA seqDB search
MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLKQENLLPDIVHTSLLR
RAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKEKYGNDQFMAWRRSYDV
RPPDLDRDSEFSQFHDPRYADIPESERPVAECLKDVVARMVPYFTSDIAADLKDGKTVLV
AAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLKPVTKGGRYLDPEAAAAGA
KAVANQGNK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagctcatcctgctccgccatggcgagagcgaatggaactccaagaacctc
ttcaccggctgggtggacgtcgatctcaacgagaagggcgagggcgaggctcgtcacgcc
gccgacctgctcaagcaggaaaacctcctgcccgatatcgtccacacctcgctgctacgt
cgtgctatccataccgcctacctagcccttgacggctgcgaccgccattggatcccggtg
catcgttcctggcgcctcaacgagcgtcactacggtgcgctgcagggtctcaacaaggct
gagaccaaggagaagtacggcaacgaccagttcatggcttggcgtcgctcctacgatgtt
cgtccaccggaccttgaccgcgacagcgaattcagccagttccatgacccgcggtacgcc
gacatcccggagtccgagcgtccggtcgccgagtgtctcaaagacgtcgtggcccgcatg
gtgccgtacttcacctctgatattgctgccgaccttaaggacggcaagacggtgctcgtg
gctgctcacggtaactccctgcgcgccctcgtcaagcacctcgacgagatcagtgacgag
gacatcgccggcctcaacatcccgaccggtatcccgctgttctacgagcttgacgacaac
ctcaagcccgtgactaaggggggccgctacctcgaccctgaggccgctgccgccggtgcc
aaggcagtcgctaaccagggaaacaagtaa

DBGET integrated database retrieval system