KEGG   Propionibacterium acnes ATCC 11828: TIIST44_06535Help
Entry
TIIST44_06535     CDS       T01972                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIIST44_06535
   01230 Biosynthesis of amino acids
    TIIST44_06535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_06535
  Energy metabolism
   00680 Methane metabolism
    TIIST44_06535
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIIST44_06535
Enzymes [BR:pad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TIIST44_06535
Exosome [BR:pad04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TIIST44_06535
  Exosomal proteins of melanoma cells
   TIIST44_06535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1406655..1407404)
Genome map
AA seq 249 aa AA seqDB search
MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLKQENLLPDIVHTSLLR
RAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKEKYGNDQFMAWRRSYDV
RPPDLDRDSEFSQFHDPRYADIPESERPVAECLKDVVARMVPYFTSDIAADLKDGKTVLV
AAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLKPVTKGGRYLDPEAAAAGA
KAVANQGNK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagctcatcctgctccgccatggcgagagcgaatggaactccaagaacctc
ttcaccggctgggtggacgtcgatctcaacgagaagggcgagggcgaggctcgtcacgcc
gccgacctgctcaagcaggaaaacctcctgcccgatatcgtccacacctcgctgctacgt
cgtgctatccataccgcctacctagcccttgacggctgcgaccgccattggatcccggtg
catcgttcctggcgcctcaacgagcgtcactacggtgcgctgcagggtctcaacaaggct
gagaccaaggagaagtacggcaacgaccagttcatggcttggcgtcgctcctacgatgtt
cgtccaccggaccttgaccgcgacagcgaattcagccagttccatgacccgcggtacgcc
gacatcccggagtccgagcgtccggtcgccgagtgtctcaaagacgtcgtggcccgcatg
gtgccgtacttcacctctgatattgctgccgaccttaaggacggcaagacggtgctcgtg
gctgctcacggtaactccctgcgcgccctcgtcaagcacctcgacgagatcagtgacgag
gacatcgccggcctcaacatcccgaccggtatcccgctgttctacgagcttgacgacaac
ctcaagcccgtgactaaggggggccgctacctcgaccctgaggccgctgccgccggtgcc
aaggcagtcgctaaccagggaaacaagtaa

DBGET integrated database retrieval system