KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_07210Help
Entry
TIIST44_07210     CDS       T01972                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00040  Pentose and glucuronate interconversions
pad00052  Galactose metabolism
pad00500  Starch and sucrose metabolism
pad00520  Amino sugar and nucleotide sugar metabolism
pad01100  Metabolic pathways
pad01130  Biosynthesis of antibiotics
Module
pad_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TIIST44_07210
   00052 Galactose metabolism
    TIIST44_07210
   00500 Starch and sucrose metabolism
    TIIST44_07210
   00520 Amino sugar and nucleotide sugar metabolism
    TIIST44_07210
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TIIST44_07210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-ProteinID: AER05909
Position
1535844..1537241
Genome map
AA seq 465 aa AA seqDB search
MSEEGLAAARQKMTEAGVDPVAIEVFTSYYHQLETGDTGLIREDTISPLTDPPMLDDVEV
SEEQAAEALDKTVIIKLNGGLGTSMGLDRAKSLLEVRDGKSFLDIIATQVLSARKAFGAR
LPLMFMNSFNTREDTLKALEKYPDLAVDSLELDFLQDQEPKLDAETLAPVEWPKNPSLEW
CPPGHGDLYTALLGSGVLDHLLEAGYQYASVSNGDNLGAVPDGRLTGWFAASGAPYAAEL
CRRTINDKKGGHLAIRKSDDQLILRDTAQTAEEEMDYFTDEHRHPFFHTNNLWFDLEALK
KVLDERHGVMGLQIIRNEKTVDPKDSSSTPVIQIESAMGGAIEVFEGATCICVDRSRFLP
VKTTNELLLLRSDVYDLDDFDHLVKTTDMTCAVDLDKDFYKKIGDFDDRIPEPPSLRRAT
SLKVKGDWTFGSEVVVAGDISLDTEKPQTIPDGTVLTGEVPGAKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagagggacttgcggctgcacgccaaaagatgaccgaggcaggtgtcgatcct
gtcgccatcgaggtcttcacctcctactaccaccaacttgagaccggcgataccggactc
atccgcgaggacaccatctccccgctcactgatccgccaatgctcgacgacgttgaagtc
agcgaggagcaggctgctgaggccctcgacaagactgtcatcatcaagctcaacgggggg
cttggaacctcaatgggcctcgaccgagctaagtcactgctcgaggtgcgtgatggcaag
tccttcctcgacatcatcgccacccaggtgctctcggcccgcaaagctttcggcgctcga
ctgccgctgatgttcatgaattccttcaatacccgcgaggacaccctcaaggccctcgag
aaatatccggacttggctgtcgacagcctagagctcgacttcctgcaggatcaggagcct
aaactcgacgctgagaccctcgccccggttgagtggccgaagaatccctccctcgagtgg
tgccctccgggccacggcgacctctacaccgccctgcttggatccggcgtcctcgaccat
ctgctcgaggctggataccaatacgcctcggtatccaacggtgacaatcttggtgccgtt
ccggacggtcgtctcaccggctggtttgcggcgtcaggtgctccctacgctgccgagttg
tgccgtcgcactattaacgacaagaagggtggccacctggccattcgtaagtctgatgat
cagctcatcctgcgcgatacggcacagacagcagaggaggagatggattacttcaccgac
gagcatcgtcaccccttcttccacaccaacaatctgtggtttgaccttgaagccctcaag
aaggtgctggacgagcgacacggcgtgatgggcctgcaaattattcgcaacgagaagacg
gtcgacccgaaggattcctcatcgactcctgtcatccagattgagtccgctatggggggc
gctatcgaggtctttgaaggcgctacctgtatctgtgttgatcggtcccggttcttgccg
gtcaagacgaccaacgagttgctgctgcttcggtctgatgtctatgacctcgatgatttc
gaccacctcgtcaagaccaccgacatgacctgcgcagtcgatcttgacaaggatttttac
aaaaagattggtgatttcgacgatcgcatccctgagccgccatcgctgcgtcgcgccacc
tcgctgaaggtcaagggagactggacctttggttcggaggttgtcgttgcgggggatatt
tccctggatactgagaagcctcagacgattccggacgggactgtgctcactggcgaagtc
cctggcgcgaaaaagtga

DBGET integrated database retrieval system