KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_07415Help
Entry
TIIST44_07415     CDS       T01972                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00900  Terpenoid backbone biosynthesis
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01130  Biosynthesis of antibiotics
Module
pad_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TIIST44_07415
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TIIST44_07415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AER05950
Position
1577339..1578310
Genome map
AA seq 323 aa AA seqDB search
MVMMDDPFDLLRPMTVTVRVSAKVNLALGVGGLAPDGFHPLATVFEAICIYDEVAVTRRD
DSRITLTVSGEDADQVPTDETNLAWRAIELVREEFASEWGKRGHGADIHIDKSIPVAGGM
AGGSADAAGALMAAAALCRLPYSPEELQPLAAQLGSDVPFCLTGGVALGRGRGDRLAPVI
CRGRHRWVFATSNQGLSTPAVYRRFDELGGTPGGETVPNDLISALTRGDLDVVAASLSND
LQAAAIDLRPELEEVLTVGREVGALTALVSGSGPTCAFLVRDTAGAKKVSAAVANLPQVH
RTRTARGPAAGAQLLPGPVGSFA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgatggacgatccgtttgacttgctccggccgatgaccgtgacggtgcgggtc
agcgccaaggtcaatctggcgctcggggttggcggccttgcgcccgacggctttcacccg
ttggcgactgtcttcgaagctatctgcatttacgatgaggtggcggtgactcgtcgcgac
gattcgcgcatcaccctcaccgtctcaggagaggacgccgatcaggtccctaccgacgag
acgaatttggcctggcgagctatagaactcgttcgcgaggaattcgcttcagaatggggg
aaacgtggccatggcgccgacattcacatcgataagtcgatcccggtcgctggtgggatg
gctggaggatcagctgacgcagcgggcgcccttatggcagcggccgcgttgtgtcggctc
ccttactcccccgaggaattacaaccgttggctgctcagcttggctccgacgtgcccttc
tgtctcaccggtggagtggcgttagggcgaggtcgaggagaccgtcttgcgccagtgatc
tgccgaggacgtcatcgctgggtgttcgcgacatcgaatcagggactgtccaccccggct
gtctaccgacgtttcgacgagttgggcggcacccctgggggagaaacggtgcccaatgac
ctcatctcggctttgacccgcggcgatcttgatgttgtcgctgccagtctgagcaatgac
ttacaggccgctgccatcgaccttcggcccgaactcgaagaggtgttgacagttgggcga
gaggtgggtgcgttgaccgctttagtttctggatcggggccgacctgcgccttcctcgtc
cgggacaccgctggcgccaagaaggtgagcgctgctgtggccaatctgcctcaggttcat
cgcacccgaactgcccgtggtccagctgcgggagcgcagctcctgcctggcccggtgggg
agctttgcatga

DBGET integrated database retrieval system