KEGG   Propionibacterium acnes ATCC 11828: TIIST44_07695Help
Entry
TIIST44_07695     CDS       T01972                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TIIST44_07695 (deoA)
Enzymes [BR:pad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TIIST44_07695 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1633943..1635232)
Genome map
AA seq 429 aa AA seqDB search
MTSTYSVVDLIRAKREGQALNSDQIAWLIRAYTDDIVADEQMSAMAMAVYFQGLDDAELS
AWTTAMIESGERMSFVGLSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGH
TGGTLDKMEAIPGWRADLSHDEMVAQLEKVGAVICAAGPGLAPADKKLYALRDVTGTVES
IPLIASSIMSKKIAEGTDSLVLDVKTGSGAFMKTDKDARELASRLVELGEAAGVRTTALL
THMDVPLGYACGNGIEVAESLEVLAGGGPADVVELTVALARHMMKVAGLDGIDPADVLAN
GQAMDVWRNMVRAQGGDPDAPLPVAHHSQDIVATETGVITGIDAMSVGLAAWRLGAGRAR
KEDPVQAAAGVMLRVRPGDRVVTGQPLATLLTDTPDSIARAEDAMTNAFTVGQTFQPQDI
VIDTVVARS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcacctattccgtcgtcgaccttatccgcgctaagcgcgaaggccaggctctc
aactccgaccaaatcgcatggcttatccgcgcctacaccgacgacatcgtcgccgacgag
cagatgtctgccatggcgatggcggtgtacttccaggggctcgacgacgctgagctgtca
gcctggacgacggccatgatcgagtcgggcgagcggatgtccttcgttgggctatcccgc
cccaccgtcgacaagcactccactggcggcgtgggcgacaaaattaccttgccgctggct
cccctggtggccgcatgcggtgctgccgtcccacagctgtctgggcgtggcctgggccac
accggaggcaccctcgacaagatggaggccattcccggatggcgggcggatctctctcat
gacgagatggtcgcccagctcgagaaagtcggcgctgtcatctgcgcagcgggcccggga
ctagcccctgctgacaagaagctctacgccctgcgcgacgttaccggcaccgtcgagtcc
atcccgctgatcgcttcgtccatcatgagcaagaagatcgccgagggcaccgacagcctc
gtcctcgatgtcaaaaccggctcaggtgccttcatgaagacagataaggacgcccgcgag
ctcgccagccgtctcgtcgagttaggtgaagccgccggggtgcgtaccaccgccctactg
acccacatggacgtcccactgggttacgcttgcggtaacggcatcgaggttgccgaatcc
ctcgaggtgttagccggcggaggtcctgccgacgtcgtcgagctcaccgtcgccttggcc
cgtcacatgatgaaggtggctggattggacggcatcgacccggccgatgtactcgccaat
ggccaggcaatggatgtctggcgcaacatggttcgtgctcagggcggcgaccctgacgct
ccactaccggtggcccaccattcccaggacatcgtcgccaccgagactggcgtcatcacc
gggattgatgccatgtccgttggcctagctgcctggcgtttgggtgccggacgcgcccgc
aaagaggatccggtgcaggctgcggctggcgtcatgttgagagttcgtcccggcgaccgc
gttgtcacgggccagccattggccaccctgctcaccgacacccccgactccattgcgcgg
gccgaggatgccatgaccaacgcgttcaccgtcgggcaaaccttccagccgcaagacatt
gtcatcgacaccgtcgtagcccgatcgtga

DBGET integrated database retrieval system