KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08010Help
Entry
TIIST44_08010     CDS       T01972                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pad00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TIIST44_08010
Enzymes [BR:pad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TIIST44_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1698463..1700349)
Genome map
AA seq 628 aa AA seqDB search
MTDLVPVAAGSRLEPFARAGVLEASDIHLANLVCRIGGETNCDVSLAIALSCRELRRGSV
FWDPHEIADVVRQQILDPAIPDIETSDQAALFAELEWPHPGEWLSTLEASPVIAGRDDPI
NRLPARLDDGLVYLEKYWQAEHDVARDLATLAADSPSQGRVLADDVVSSVSNALAASGII
LDPAQADAAIAAIMHRVSVLAGGPGTGKTTTVCALLAALQQADPHLGAVALAAPSGKAAA
RLRDSVSHVSERIPDDLKPIVADATTVHSLLKWQGPGTSFGYDEQHKLPFGVVVVDEASM
LSLPLAASLLSAIGPQTRLILVGDPGQLVSVDAGSVLADIVSSADALQAQLPVTILTYNH
RSRGDIARLSEAVREGDKSAALDVLATAAGVTHDSPSPDCIATISGRRSITWIDADPASI
TMADLPAIAEVIARTGARMLELAQASADAAALKLVDAHRLLCAHREGPYGVDEWSQRMAT
VLSDVLPGVGQGRWVLGETAIVTHNLAQLGVNNGDCGVIVETRPVPTIALPGPGGVPRRL
PCSLIPSLQPLQAMTIHKAQGSQFTDVTVVLPPPDSPLLSRELLYTAITRAREHLTVVGT
RESVERAIDRANDRRSGIQRRWEESRTS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctcgtcccggtagcagcaggaagtcggctcgagcccttcgcccgagccgga
gtcctcgaggccagcgacatccatttagccaatctagtgtgccgcatcggtggcgagacc
aactgcgatgtcagcctcgccatcgctttatcatgccgtgagcttcggcgcgggtccgtg
ttttgggaccctcatgaaatcgcagacgtcgtccgccagcaaatccttgatccggcaatt
ccagacatcgaaaccagcgaccaggcagccctattcgcggaattggaatggccacatcca
ggcgagtggctgtccacgctagaggccagccccgtcattgctggccgtgatgatccgatc
aaccggttaccggctcggcttgatgatggtctggtctacctagagaaatattggcaagct
gagcacgatgtcgcccgcgatctcgctaccctcgctgcggattcaccaagccaaggccgt
gtgttggccgacgatgttgtttccagcgtcagtaatgccttagcagcatccggaattatt
ttggatccagctcaagctgatgctgccatcgccgcaattatgcaccgagttagtgtgctt
gcaggtggccccggaaccggcaagacaactacggtatgtgccctcctagctgccttgcaa
caggctgaccctcatcttggagccgtggcccttgcggctcccagcggcaaggcagcggca
cgcttgcgtgactcagtttcgcacgtttcagagcgaattcccgatgatctgaaaccgatt
gttgctgacgcaactactgtccactcactgctgaaatggcaggggccgggaacttcattc
gggtatgacgagcaacacaagcttccgttcggagtcgtcgttgttgacgaagcatcaatg
ctttctctgcctctggccgctagcctcctctctgcaatcgggcctcaaactcgtttaatt
ctcgtcggggacccagggcagcttgtctcggtggacgccggtagcgtgttggccgacatc
gtttcgtcggctgatgccctccaagcgcaacttcctgtcacgatcctcacctataaccac
cgctcgagaggagatatcgcacggctgtcggaggcggtacgcgagggagacaagagcgct
gcgttggacgtattggcgacagctgctggagtgacacacgactctccttcccccgattgc
atcgcgacgatcagtggccgtcgcagtattacgtggatcgacgctgacccggcgagtatc
accatggccgaccttccggcgatcgcggaggtgatcgcacgcaccggggcaagaatgctt
gagcttgctcaggccagtgccgacgctgctgctctcaaactcgtcgatgcccaccggttg
ttgtgcgctcaccgagaggggccatacggggtagacgagtggtctcagcgcatggctact
gtgctttcagatgtgttgcctggtgttggccaaggccggtgggttctcggcgaaactgcg
atagtgacgcataacctcgcacaattgggagtcaataacggtgattgcggggtcatcgtt
gaaacaaggcccgtccccacgatagctctaccgggacccggtggagtccccagacggttg
ccctgttccctcatcccatcgctgcaacccttacaggcgatgacgattcacaaagcgcag
ggcagccaattcacggacgtaacggtggtcctgccaccgcctgactcgcccctcctctct
cgtgagttgctctataccgccatcacgcgtgcacgtgaacacctcactgtggtaggcaca
agggagtctgtggagagggcgattgaccgggctaatgatcgacgttctgggattcagcgc
cggtgggaagaaagtcgcacttcctga

DBGET integrated database retrieval system