KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08335Help
Entry
TIIST44_08335     CDS       T01972                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIIST44_08335
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIIST44_08335
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TIIST44_08335
Enzymes [BR:pad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TIIST44_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1767268..1768344
Genome map
AA seq 358 aa AA seqDB search
MIMSQQNRLFGVIETYRDRLPMDGIDQIVTLGEGATPLVPAPRLGTELDATVWIKVEGAN
PTGSFKDRGMTMAMTKALADGSKAVVCASTGNTSASASAYASRAGMTPVVLLPQGKIAAG
KLAQAVVHGGRIIQVLGNFDDCLRIARELAENFPVSLVNSINPYRIEGQKTAAFEVVDVL
GDAPNIHALPVGNAGNITAYWKGYREYVADGPASHTPRMFGFQAAGAAPLVLGHDVNDPE
TVATAIRIGRPASGKLALAARDESEGLIDAVTDEQILDAQAFLAAREGIFVEPASAAGVA
GLFKLKSEGRLDPGLRIVVTVTGNGLKDIDTALSRTTLSTEAVEASTDQVAALLDFCS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatgagccagcagaatcgtctcttcggcgtgattgaaacctatcgagatcgtctc
cctatggacggaattgaccagatcgtgacattgggggagggggcgaccccgttggtgcct
gccccacgattgggcaccgagcttgacgcgacggtatggattaaagttgaaggggccaat
ccgaccggatcgttcaaggatcgtggcatgacgatggctatgacgaaagcccttgccgac
ggctcgaaagccgtggtgtgtgcctctaccggtaatacctctgcctcggcatcggcttac
gcctcccgagccggcatgactccggtcgtgctccttccccagggcaagattgcagctggc
aaactcgcccaggctgttgtccatggcggtcgaatcatccaggttctcggcaacttcgac
gattgcctgcgtattgcccgcgagctggccgagaatttcccggtctccttggtgaactcg
atcaatccgtaccgcatcgagggacagaaaactgccgcctttgaggtcgttgacgttctt
ggtgacgctcctaatatccacgctcttccggtgggcaacgcaggcaatatcaccgcgtat
tggaagggttaccgcgagtacgtagcggacggtcctgccagccacacgccgcggatgttc
ggattccaagccgctggcgcagcccccctggtgctgggccacgacgttaatgacccggaa
acggtagccaccgccattcgtatcggtcgtccggcctccggcaagctggcgttggccgct
cgagacgagtcggaggggctcatcgacgctgtcacggacgagcaaattcttgacgcccag
gccttcctagctgctcgagagggcatttttgttgaaccggcatcggcagccggagtggca
ggtttgttcaagttgaagtccgagggacgcctggatcctggactgcgcatcgtcgtcacg
gtaactggaaacggtctgaaagacattgacactgcattgagccgcactaccttgtcaacc
gaggctgtggaagcttcgactgaccaggttgccgctttgttggacttctgttcctga

DBGET integrated database retrieval system