KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08335Help
Entry
TIIST44_08335     CDS       T01972                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIIST44_08335
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIIST44_08335
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TIIST44_08335
Enzymes [BR:pad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TIIST44_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1767268..1768344
Genome map
AA seq 358 aa AA seqDB search
MIMSQQNRLFGVIETYRDRLPMDGIDQIVTLGEGATPLVPAPRLGTELDATVWIKVEGAN
PTGSFKDRGMTMAMTKALADGSKAVVCASTGNTSASASAYASRAGMTPVVLLPQGKIAAG
KLAQAVVHGGRIIQVLGNFDDCLRIARELAENFPVSLVNSINPYRIEGQKTAAFEVVDVL
GDAPNIHALPVGNAGNITAYWKGYREYVADGPASHTPRMFGFQAAGAAPLVLGHDVNDPE
TVATAIRIGRPASGKLALAARDESEGLIDAVTDEQILDAQAFLAAREGIFVEPASAAGVA
GLFKLKSEGRLDPGLRIVVTVTGNGLKDIDTALSRTTLSTEAVEASTDQVAALLDFCS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatgagccagcagaatcgtctcttcggcgtgattgaaacctatcgagatcgtctc
cctatggacggaattgaccagatcgtgacattgggggagggggcgaccccgttggtgcct
gccccacgattgggcaccgagcttgacgcgacggtatggattaaagttgaaggggccaat
ccgaccggatcgttcaaggatcgtggcatgacgatggctatgacgaaagcccttgccgac
ggctcgaaagccgtggtgtgtgcctctaccggtaatacctctgcctcggcatcggcttac
gcctcccgagccggcatgactccggtcgtgctccttccccagggcaagattgcagctggc
aaactcgcccaggctgttgtccatggcggtcgaatcatccaggttctcggcaacttcgac
gattgcctgcgtattgcccgcgagctggccgagaatttcccggtctccttggtgaactcg
atcaatccgtaccgcatcgagggacagaaaactgccgcctttgaggtcgttgacgttctt
ggtgacgctcctaatatccacgctcttccggtgggcaacgcaggcaatatcaccgcgtat
tggaagggttaccgcgagtacgtagcggacggtcctgccagccacacgccgcggatgttc
ggattccaagccgctggcgcagcccccctggtgctgggccacgacgttaatgacccggaa
acggtagccaccgccattcgtatcggtcgtccggcctccggcaagctggcgttggccgct
cgagacgagtcggaggggctcatcgacgctgtcacggacgagcaaattcttgacgcccag
gccttcctagctgctcgagagggcatttttgttgaaccggcatcggcagccggagtggca
ggtttgttcaagttgaagtccgagggacgcctggatcctggactgcgcatcgtcgtcacg
gtaactggaaacggtctgaaagacattgacactgcattgagccgcactaccttgtcaacc
gaggctgtggaagcttcgactgaccaggttgccgctttgttggacttctgttcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system