KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08485Help
Entry
TIIST44_08485     CDS       T01972                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TIIST44_08485
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TIIST44_08485
Enzymes [BR:pad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     TIIST44_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1794072..1795598
Genome map
AA seq 508 aa AA seqDB search
MDNITPASVGRLIRDARKQHGMTQNQLAEILKTSQSAIHRVESGTQNLSLEYINRITEAL
ESPIITQPGSGTMNYRIEGGHQLSGSIEVRSSKNAAVALLCACLINRGRTVLRGIAHIEE
VNRILEVLTSIGVTYEWSDDEHDLTLIRPAELNLDDMDIEAARRTRSVIMFLGPLMRFYD
TFKLPYAGGCNLGARTVEPHLQVLRAFGLDVVATEGFYQCHVTDRTVKERHIVLTERGDT
VTENALLAAAQTPGVTVLRNASSNYMVQDLCVFLCQLGVQIEGIGTTTLRIRGVEEIDVD
VEYAPSEDPIEAMSLLTAAVVTKSELTITRCPIEFLEIELAILSEMGLDFDLSPEYVSRN
GFTRLVDVTVRPSKLRAVADKIHPMPFPGLNIDNLPFFAVIAAEAEGQTLIHDWCYENRA
IHLLDLGKLGADVQLLDPHRLIVRGPTRWRGRELICPPALRPAVCLLLAALAASGETTLR
DVYMINRGYEDLPTRLGALGAKITVFHG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacatcaccccagcttcggtcggtcgtcttatccgcgacgcacgcaagcagcat
ggaatgacgcagaaccaattggcggagatcctgaagacctcccagagcgctatccaccgg
gtggaatcaggcacgcagaacctctctctggagtacatcaaccgcatcacggaggcgtta
gagtctcccatcatcacccagccgggaagcggtaccatgaattaccgcatcgaaggaggt
catcaactttcgggctctatcgaggtgcggtcctccaaaaacgcggccgtcgcgctgcta
tgcgcctgtctcatcaacaggggccgtaccgtgctacgcggtatcgcccacatcgaggag
gttaaccgcattcttgaggtgctgacctccatcggcgtcacctacgagtggtctgacgac
gagcatgatctcaccctgattcgtccggctgagctcaaccttgacgatatggacatcgag
gccgcccgacgtacccgaagcgtcatcatgttcctcggaccgttgatgcggttctacgac
accttcaaactcccctacgccggcggctgcaacctcggcgctcgaactgtcgaacctcac
ctgcaggtgctacgtgctttcggccttgacgttgttgccaccgagggcttttaccagtgc
cacgtcaccgatcgcaccgtcaaggagcgtcacatcgtcctgactgagcgtggcgacact
gttaccgagaatgctctgctggctgccgcccagacccccggcgtgactgtgctgcgtaat
gccagctcgaactatatggttcaggacttgtgtgtgttcctatgccagctcggtgtgcag
attgagggcatcggaacgacgaccttgcgaatccgcggcgttgaagagatcgacgttgat
gtcgagtacgctccgtctgaagatccgattgaggctatgagcctcctcacggcggcggtc
gtcaccaagtcggagctgacgatcacacgctgcccgatcgaattccttgaaattgagctg
gcgatcctgtcggagatgggtctggatttcgacctctcccccgagtacgtctctcgcaac
gggttcacccgtctcgttgatgtcacggtgcgccccagcaagttgcgagcggtagctgac
aaaatccacccgatgccctttccgggcctcaacatcgacaacctaccgttctttgcggtt
attgctgcggaggcagaaggccagaccctcatccatgactggtgctacgagaatcgtgcg
atccacttgctcgatttgggcaaacttggcgctgacgttcagctgctcgatccgcaccgt
ctcatcgtgcggggcccgacccgttggcgtggtcgcgaactcatctgcccgccggccttg
cgtcctgccgtctgtctgctattggccgctctggccgcttcgggagaaacgaccctgcgc
gacgtctacatgatcaaccgcggttacgaagatctcccgactcggcttggggcgttggga
gccaagatcaccgtcttccatggctga

DBGET integrated database retrieval system