KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08570Help
Entry
TIIST44_08570     CDS       T01972                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TIIST44_08570
Enzymes [BR:pad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TIIST44_08570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1808453..1809367
Genome map
AA seq 304 aa AA seqDB search
MDIAVVGSNMVDLISYIHRMPSDGETVEAPEFRMGCGGKGANQAVAASRLGAEVVMVTRV
GNDVFAGTTLENFRKNGIDTTHVLRTDASSGVAPIFVDPESRNSILIIKGANAQLSPADV
EGARQDIATCKLIMLQLEIPLETVYATIELGDVLGIPVLLNPAPVAPELDLERIRGIEFF
MPNESELERITGMPVDTLDDIGKATDVLLGVGITNIIVTLGSRGAMWAHAEGRKIIKAPV
VHAVDTTGAGDAFIGCFAKEWVDHGDVTAAIRAGNRYAADSVTRHGTQSSYALADGSFPE
WLRS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccgttgttgggtccaatatggtggacctcatctcctacattcatcgcatg
ccatcagacggtgaaaccgtcgaggctcccgaattccgaatgggatgcggcggcaagggt
gcgaatcaggcagtagccgcgtcacgtctcggtgcagaggtcgtgatggtcacccgagtg
ggcaacgatgtgttcgccggcaccacgttggaaaactttcgcaaaaacggtatcgatacc
acccatgtgttacgtaccgatgcgagctccggggtggcaccgatcttcgtcgatccagaa
tcgcgtaactccatcctcatcatcaagggagctaacgctcagctgagtcctgctgatgtc
gagggtgcccgacaagacattgccacgtgcaaactcatcatgctgcagctggagattccg
ttggagacggtctacgccacgattgagttaggggacgtactgggaatcccagtactcctc
aatccggctccggtcgcaccagaactggatcttgagcgaatccgcggaattgagttcttc
atgccgaacgagtccgagcttgaacgtataacagggatgccggtagacaccctcgatgat
atcggcaaggctactgatgtgctgctgggcgtgggcatcacgaatatcatcgtaactttg
ggctcgcgtggtgcgatgtgggcccacgcagaaggacgcaaaatcatcaaggccccggtt
gttcacgccgtggacacgacaggtgctggcgatgccttcataggctgctttgctaaagaa
tgggtagatcacggcgacgtgacagctgcgattcgtgcaggaaacaggtatgcggctgac
tcggtcacacgccacggaactcagagctcgtatgccttggccgatggaagtttcccggag
tggctgagatcataa

DBGET integrated database retrieval system