KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08840Help
Entry
TIIST44_08840     CDS       T01972                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pad00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TIIST44_08840
Enzymes [BR:pad01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TIIST44_08840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1868906..1869511)
Genome map
AA seq 201 aa AA seqDB search
MISHFSGTVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALAPRGASASGATHVAAPWREQVAEGLVGLGWSTKDAEKAVDKVVALK
EADPAMSIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcacggtaagtgctgccggcccgacttgggtcgtccttgac
aatcatggggtcggtatcaaggtgctatgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacttccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
attaccgaagaagatgacgcaactctatgccgcgttcccggtattggtcgcaaaggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttgccccacgcggagcttcg
gcgagcggagcaacccatgtggccgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcgactaaagacgcggagaaggccgtcgacaaggtggttgctctcaag
gaagccgatccagctatgagcatcggcaacctcatgcgagcggcgttgcgtagtttggcg
cggtga

DBGET integrated database retrieval system