KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08915Help
Entry
TIIST44_08915     CDS       T01972                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIIST44_08915
Enzymes [BR:pad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     TIIST44_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1882522..1883952)
Genome map
AA seq 476 aa AA seqDB search
MKRILWGGATAASQYEGGFYDGKGMDTQDCRRWIPRLSSDTVQTRLLTEADVRNAKNSRS
DDCRFPFRMGSRGYEYWESDLHYITSLGLDVYRLSISWARLFPTGFEDQPNPEGVMYYDR
IIRTLAHAGIKVFITINHYAMPIAIVGKYGGWRHRDVIDLYLKMAKFVVYRWQENVDYWL
PINEINSGYFSPYNGLGIIGSIDHSYDYQAVFNGLHYQMIASALITKYGRDIGVRGKFVC
MVSCFDYYALHPTPEDNMKLVHDEQINQWWCADVLATGEYGYYTEKFLADHGVVLDVTDK
DRGILRSNTCDVVSFSYYSSSICSVDEKREQVPGNLVPTLRNPSLEATEWGWQIDPMGLR
IAAHKVYDRYRKPIMVAENGLGARDNIDSDGRIHDDYRISYLERHMEQAELAVREGVGIE
AYFVWGIIDIVSAGSCEMEKRYGVVYVDADNEGRGTYKRLPKDSFYWYRDFIASHR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattctgtggggtggggctaccgcggccagtcaatatgaaggcggattctac
gatggaaagggaatggacacccaagactgtcgtcgatggattccacggctatcgagtgat
accgtacaaactcgtctcctcaccgaggctgacgttcgaaacgcaaagaattcccgttct
gacgactgccggttcccgttccgtatgggctcgcggggttacgaatactgggagtcagac
ttgcattacattaccagtcttggcctagatgtatatcgtctttcgattagctgggcccgt
ctatttcccactggtttcgaggaccagcccaatccggaaggcgtgatgtactatgaccgg
attattcgcacccttgcacatgctggaattaaagtcttcattacgatcaatcactatgcg
atgccgattgctatcgttggcaaatacggaggttggcgacatcgtgacgtcatcgatctg
taccttaagatggcgaaatttgtcgtctatcgctggcaagaaaatgtagactattggctt
cccataaatgagattaattccggatatttcagtccttataatggactcggaataatagga
tccatcgatcactcttatgattatcaggcagtctttaatggtcttcattaccaaatgata
gcaagcgccctaataacaaaatacggtcgcgatatcggagtacgaggaaaattcgtgtgc
atggtgagctgtttcgattactatgcgctccatcccacacctgaggacaacatgaagctc
gttcacgacgagcagatcaatcagtggtggtgtgcggatgtacttgcaacaggtgaatac
gggtattacacagagaagttcttagccgaccacggggtagtactcgacgtcacggacaag
gaccgtggcatactcaggtcgaatacctgtgatgtcgtgtcattttcgtactattcatcg
tcgatttgtagtgtcgacgaaaaacgtgaacaagtccccggaaacctggtaccaacattg
agaaaccctagtttagaagctaccgagtggggatggcagatagacccgatgggtttgagg
attgcggctcacaaggtttacgaccggtaccggaagcccataatggttgctgagaatgga
ttaggtgcacgggataatatcgactctgatggacgtatccacgatgactatagaatatca
tatctcgagcgccatatggaacaggctgagcttgccgtgcgggagggtgtaggtatagaa
gcatatttcgtttggggcatcattgacatcgtcagtgccggtagttgcgaaatggagaaa
aggtacggtgtcgtctatgtagacgcagacaatgaagggcggggaacttataaacggttg
ccgaaagatagtttctattggtatcgcgacttcatcgcctctcataggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system