KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_08980Help
Entry
TIIST44_08980     CDS       T01972                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00260  Glycine, serine and threonine metabolism
pad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
pad01130  Biosynthesis of antibiotics
pad01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIIST44_08980 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TIIST44_08980 (trpA)
Enzymes [BR:pad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TIIST44_08980 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AER06256
Position
complement(1900046..1900879)
Genome map
AA seq 277 aa AA seqDB search
MTGSASAYLRAREENRPALVGYLPVGHPSVPHSIDAMKALTTGTTGTGVDLVVIGMPYSD
PMMDGTVIQHVTTWALERGVRTRDTLLAAEAVAGTGTPCVIMTYWNLVEHYGVDAYARDL
ASAGGLGLITPDLTPDEAEEWMAASDAYGLDRVFLVAPSSTHERLTSTVAACRGWIYATS
IMGATGTRTQKSSTAPELVARVRGVDPDIAVGVELGVSNGDQAAEVGSFADGVIVRSALV
RAFVEAEDRGDSVTVGIDRMCAIVDDLAAGVRRAERQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtagcgccagtgcctacctcagggcccgcgaagaaaaccgcccggccctcgtc
ggttacctcccggtgggacacccgtcagttccgcactcgatcgatgctatgaaggcactg
actacggggactactgggactggcgtcgacctcgtcgtgatcggaatgccttattccgac
ccgatgatggacggcaccgtcattcagcacgtcactacctgggctctagagcgcggggta
cgcacccgcgacaccctattggccgcagaggccgtggccgggaccggaactccgtgcgtg
attatgacctattggaaccttgtcgagcactacggtgtcgacgcttatgctcgcgatctg
gcatccgcgggtggcttagggctcatcaccccggacctcacccccgatgaggctgaggag
tggatggcagcttccgatgcttacgggctagaccgtgtcttcttggttgcaccttcctcc
actcatgagcgactgacgtcaacggtcgcggcctgccgcggctggatttacgccacctca
ataatgggagcgacgggaactcgaacccagaagtcttcgacagcccccgaattggtagcc
cgggtgagaggtgttgaccccgacattgcggtgggtgtcgagttgggggtgtccaatggc
gaccaggctgccgaagttggctcttttgctgacggcgtcatcgtaaggtcagctctagta
cgtgctttcgttgaggctgaggatcggggggactcagtgacggtaggaattgaccggatg
tgcgccatcgtcgacgacctggcggccggagtacggcgggcggaacgccagtga

DBGET integrated database retrieval system