KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08980Help
Entry
TIIST44_08980     CDS       T01972                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pad01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pad00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pad00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1900046..1900879)
Genome map
AA seq 277 aa AA seqDB search
MTGSASAYLRAREENRPALVGYLPVGHPSVPHSIDAMKALTTGTTGTGVDLVVIGMPYSD
PMMDGTVIQHVTTWALERGVRTRDTLLAAEAVAGTGTPCVIMTYWNLVEHYGVDAYARDL
ASAGGLGLITPDLTPDEAEEWMAASDAYGLDRVFLVAPSSTHERLTSTVAACRGWIYATS
IMGATGTRTQKSSTAPELVARVRGVDPDIAVGVELGVSNGDQAAEVGSFADGVIVRSALV
RAFVEAEDRGDSVTVGIDRMCAIVDDLAAGVRRAERQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtagcgccagtgcctacctcagggcccgcgaagaaaaccgcccggccctcgtc
ggttacctcccggtgggacacccgtcagttccgcactcgatcgatgctatgaaggcactg
actacggggactactgggactggcgtcgacctcgtcgtgatcggaatgccttattccgac
ccgatgatggacggcaccgtcattcagcacgtcactacctgggctctagagcgcggggta
cgcacccgcgacaccctattggccgcagaggccgtggccgggaccggaactccgtgcgtg
attatgacctattggaaccttgtcgagcactacggtgtcgacgcttatgctcgcgatctg
gcatccgcgggtggcttagggctcatcaccccggacctcacccccgatgaggctgaggag
tggatggcagcttccgatgcttacgggctagaccgtgtcttcttggttgcaccttcctcc
actcatgagcgactgacgtcaacggtcgcggcctgccgcggctggatttacgccacctca
ataatgggagcgacgggaactcgaacccagaagtcttcgacagcccccgaattggtagcc
cgggtgagaggtgttgaccccgacattgcggtgggtgtcgagttgggggtgtccaatggc
gaccaggctgccgaagttggctcttttgctgacggcgtcatcgtaaggtcagctctagta
cgtgctttcgttgaggctgaggatcggggggactcagtgacggtaggaattgaccggatg
tgcgccatcgtcgacgacctggcggccggagtacggcgggcggaacgccagtga

DBGET integrated database retrieval system