KEGG   Propionibacterium acnes ATCC 11828: TIIST44_08985Help
Entry
TIIST44_08985     CDS       T01972                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pad  Propionibacterium acnes ATCC 11828
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIIST44_08985
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIIST44_08985
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TIIST44_08985
Enzymes [BR:pad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TIIST44_08985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1900876..1902132)
Genome map
AA seq 418 aa AA seqDB search
MSARDLPDARGHFDRFGGRFVPEALQAALNQLTETFEAAVTDPDFLTELEDLRREYAGRP
SPLTEAPRFSQYIFQQTGHQVRVLLKREDLNHTGSHKINNVLGQALLTRKMGKRRLIVET
GAGQHGVATATVAAMMGMECRIYMGQVDTERQALNVARMQLLGAEVIAVEAGSRTLKDAM
NEAMRDWVAHVEDTHYLIGTASGPHPFPKLVREFQRVISAEARQQCLDRVGRLPDAICAC
VGGGSNAIGSFAEFIDDPEVRLYGFEAGGDGVEIGRHAASITGGSVGVLHGTRTYILQDP
DGQTMESHSISAGLDYPGVGPEHSWLAAQKRATYLPVNDREAMEALRTLTRTEGIMPAIE
SAHAVAGVLKIAKDLPAYDDEPPVVIVTVSGRGDKDVDTALKWFAMNGSVDATTGGME
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacgagacttgcccgacgctcggggacacttcgaccgtttcggtggccgattc
gttccagaagctctccaagctgctcttaaccagcttacggagaccttcgaggccgcggta
accgatcctgactttctcactgagctggaggatctgcgccgggagtacgccggacgcccc
tctccgcttacagaggcaccgcgtttttctcagtacatctttcagcagaccggtcatcag
gtgcgagtcctgctgaagcgcgaggacctgaaccacaccggttctcacaagatcaacaat
gtgttgggccaagccctgctgactcgaaagatgggcaagcgccgtctcattgtagagacg
ggagctggacagcatggcgtggcgacggcgaccgtggccgcgatgatgggcatggagtgc
cggatctatatgggccaggtcgacaccgagcgtcaggccctcaatgtggctcgcatgcag
ctgctgggcgccgaggtcattgcagtggaagccggctcgcgcacgttgaaggatgccatg
aacgaggccatgcgagattgggtggcccatgttgaggacacccactacctcatcggtacc
gcttctggacctcacccgttccctaaactggtgcgagagtttcagcgggtcatttctgcg
gaggcccgtcagcagtgccttgatcgggttggacgccttcccgacgccatttgtgcatgt
gtcggtggtgggtcgaatgccatcggatcgttcgccgagttcatcgacgaccccgaggtt
cgtctctacggtttcgaggcgggcggtgacggtgtcgagatcggtcgccatgcagcatca
atcaccggaggttccgttggtgtgctgcacggcactcgcacctacattctgcaagatccg
gacggccagacgatggaatctcactccatatcggccggcctggactatcccggagttggc
cccgaacattcttggttagcagcccagaagcgtgctacttacctcccggtaaacgaccgc
gaggctatggaggctctacgtaccctcacccgtaccgaaggcatcatgccggccattgag
tcggcccacgctgtcgccggcgttcttaagatcgcgaaagacctgcctgcttacgacgac
gagccgccagtggtcatcgtcacagtgtcgggtcgcggggataaagatgttgacactgcc
ctgaagtggtttgccatgaacggcagcgtcgacgccactacgggaggtatggaatga

DBGET integrated database retrieval system