KEGG   Propionibacterium acnes subsp. defendens ATCC 11828: TIIST44_08990Help
Entry
TIIST44_08990     CDS       T01972                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pad  Propionibacterium acnes subsp. defendens ATCC 11828
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIIST44_08990
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TIIST44_08990
Enzymes [BR:pad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TIIST44_08990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1902160..1902960)
Genome map
AA seq 266 aa AA seqDB search
MPPTVTGTVLDGIISGILEDLHERQLMVTSDNLREAIELVAPAIDPIPRLTAPGLSVISE
IKRSSLSNSQLAAIHDPAALADQYRSGGAAAISVLTEERRFQGSLADLDAVRAKVEIPVL
RKDFVIAKYQVLEARAHGADLILLIVAALPDDDLQRLYDFAIELGMTPLVEVHTLEEVSR
ATALGARVVGVNARNLKTLEVDKTIFRELLGELPENVVKVAESGILCVGEAVEVYDLGAD
AVLVGEMLVRHGEPAQVLRKIHRATV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccactgttaccggaacggtccttgacggaatcatttccggtattctcgaagat
cttcatgagcgccaactcatggttacctcggacaatcttcgtgaggccattgagctcgtg
gcccctgctatcgatccgatcccgaggctgacagcgcccggcctgtcggttatctcagaa
atcaagcggtcgagcctgtcaaacagccagctggctgctattcatgaccctgccgcactg
gctgatcagtaccgctccggtggagccgctgctatcagcgttctgactgaggagcgccga
tttcaaggatccctggccgaccttgacgcggtgcgtgcgaaagttgagatcccagtactc
cgcaaggatttcgttatcgcgaaataccaggtgctcgaagcccgcgcacacggggcagac
cttatcctcctcattgttgccgcgttacctgacgacgacttgcaacgcctatatgacttt
gccatcgagctgggcatgaccccgctagtcgaagttcatacccttgaagaggtaagtcga
gctacagcccttggtgcccgtgtggtgggtgtgaatgcgcgcaacctcaagaccctcgaa
gtcgataagaccattttcagggaactccttggtgagctgcctgaaaacgtcgtcaaggtg
gcggaatccggaattctttgcgtgggcgaggccgtcgaggtttatgaccttggcgctgat
gcggtgttggtgggggagatgctggtccgccacggtgaaccagcacaggtattgcgcaag
atccaccgtgccaccgtgtga

DBGET integrated database retrieval system