KEGG   Cutibacterium acnes subsp. defendens ATCC 11828: TIIST44_09085Help
Entry
TIIST44_09085     CDS       T01972                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pad  Cutibacterium acnes subsp. defendens ATCC 11828
Pathway
pad00500  Starch and sucrose metabolism
pad01100  Metabolic pathways
pad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TIIST44_09085
Enzymes [BR:pad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TIIST44_09085
Exosome [BR:pad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIIST44_09085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 DUF3459
Motif
Other DBs
NCBI-ProteinID: AER06277
Position
1921349..1923283
Genome map
AA seq 644 aa AA seqDB search
MAHDEFGGLTGWDLEGFHSGGDTEVWKRLGSHVITIDDDERGPITGTRFAVWAPNAQAVE
VISDFNWWTGDRMRLIPGSGVWGTFVEGVDEGTLYKFRIQDQWGTWHEKVDPMARYSEQA
PQNASIVAETHYEWNDDEWIARREASRAHAEPMSVYEVHLGGWRHGLSYQELADQLVSYV
TWQGYTHVEFMPLAEHPFAPSWGYQVTGYFSPTSRYGSPDDLRYLIDKLHQAGIGVIMDW
VPGHFPKDDWALGRFDGTALYEHADPRQGEHKDWGTYIFNYGRNEVKSFLISSALYWISE
FHVDGLRVDAVASMLYLDYSREEGQWVPNKYGGRENLEAIDFLRYVNSHLYSRHPGILMI
AEESTSFPGVTKPVDDGGLGFGFKWNMGWMNDSLRYLELNPFHRQYHHGEMTFAMVYQYS
ENFILPISHDEVVHGKGSMITKIPGDDWQQFASLRAFYSYMWSFPGKQLVFMGQEFGQRH
EFDESVSLEWFVADLWGHGGLKRLFRDLNKIYKENPALWQLDSDPRGFEWINADDAGNNL
FSWLRRSDDGSTIACFTNFSPNPQTDYRIGLPMEGVWTEILNTDSLEYDGTGEFGNLGQI
VATPLPAPDRFRAVAAVCVPPMGSVWLRHNPSATAALPGDPGVQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgatgagttcggaggactcaccggttgggacctcgaggggttccactctggt
ggggacacggaggtgtggaagaggctcgggtcccatgtcatcactatcgatgacgatgag
cgtggtcccatcaccggcacccgcttcgctgtgtgggccccgaatgcccaggcggttgag
gtcatctctgacttcaactggtggactggtgaccgtatgcgcctcatcccggggtccgga
gtctggggcaccttcgtcgaaggagtcgacgagggaaccctctataagttccgcattcag
gaccagtggggcacctggcacgaaaaggttgacccaatggcccgttattcagagcaagct
cctcagaatgcttccatcgtcgccgaaacccactacgaatggaatgacgatgagtggatc
gcccgccgcgaagcctcccgcgctcacgccgaaccgatgagcgtctacgaggtccatttg
ggtggatggcgtcacgggctgagctaccaagagttggctgaccagctggtgagctatgtc
acctggcagggctatacccatgtggagttcatgccattggctgaacacccgttcgctccc
tcctggggataccaggtcaccgggtacttctctcccaccagccgctacggatctcccgac
gacctgcgctacctcatcgataagctgcatcaggccggtatcggagtcatcatggattgg
gttcccggccactttcccaaggacgactgggccctggggcgcttcgacggcaccgcgctt
tacgagcacgccgatccacgccagggcgaacacaaggactggggaacctatatcttcaac
tacggtcgtaacgaggtgaaatctttcctcatctcaagcgcgctgtactggattagcgaa
ttccacgtcgacggactgcgcgttgacgccgtcgcctcgatgctctatttggactactct
cgcgaagagggccagtgggtgcccaacaagtatggcggccgggagaacctagaggccatt
gacttcttgcgctatgtcaactctcacctgtactcgcgccaccccggcatcctcatgatc
gccgaggaatccactagtttccccggggtcaccaagccggtcgacgacggtggactgggg
ttcgggttcaagtggaatatgggctggatgaacgactcgctgcgatatctggagctcaac
ccattccaccgccagtaccaccatggcgagatgacctttgccatggtctaccaatactca
gagaacttcatcttgccgattagccacgacgaggtcgtgcacggcaagggatccatgatc
accaagattcccggtgacgactggcaacagttcgcgtccctgcgagccttctactcctac
atgtggtcctttcccggcaaacagctggtgttcatgggtcaggaatttggtcagcgccac
gagttcgacgagtcggtaagccttgagtggtttgtcgccgacctgtggggacacggcggt
ctcaaacgcctcttccgcgaccttaacaagatttacaaagaaaaccccgcattgtggcag
ctcgacagcgatccgcgcggattcgagtggatcaacgccgacgatgccggtaacaacctg
ttctcctggttacgccgttccgatgatggatcgacgattgcctgtttcacgaacttctct
cccaatccgcagaccgactatcgcatcggcctaccgatggaaggggtgtggaccgagatc
ctcaacaccgattccctggagtacgacggcaccggcgagttcggcaatctcggccaaatc
gtagccaccccactgccagctcccgatcgtttccgtgcggttgccgcagtgtgcgttccg
ccgatgggatcggtgtggctacgtcacaatccgtcagcaaccgctgccctgcccggcgat
ccgggcgtgcaatga

DBGET integrated database retrieval system